KEGG   Homo sapiens (human): 10507Help
Entry
10507             CDS       T01001                                 

Gene name
SEMA4D, C9orf164, CD100, M-sema-G, SEMAJ, coll-4
Definition
(RefSeq) semaphorin 4D
  KO
K06521  
semaphorin 4
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    10507 (SEMA4D)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  NRP2; neuropilin 2 [KO:K06819]
   10507 (SEMA4D)
  PLXNA; plexin A [KO:K06820]
   10507 (SEMA4D)
  PLXNB; plexin B [KO:K06821]
   10507 (SEMA4D)
CD molecules [BR:hsa04090]
 Proteins
  10507 (SEMA4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q92854(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
9q22.2
AA seq 862 aa AA seqDB search
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSV
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgtgcacccccattagggggctgctcatggcccttgcagtgatgtttgggaca
gcgatggcatttgcacccataccccggatcacctgggagcacagagaggtgcacctggtg
cagtttcatgagccagacatctacaactactcagccttgctgctgagcgaggacaaggac
accttgtacataggtgcccgggaggcggtcttcgctgtgaacgcactcaacatctccgag
aagcagcatgaggtgtattggaaggtctcagaagacaaaaaagcaaaatgtgcagaaaag
gggaaatcaaaacagacagagtgcctcaactacatccgggtgctgcagccactcagcgcc
acttccctttacgtgtgtgggaccaacgcattccagccggcctgtgaccacctgaactta
acatcctttaagtttctggggaaaaatgaagatggcaaaggaagatgtccctttgaccca
gcacacagctacacatccgtcatggttgatggagaactttattcggggacgtcgtataat
tttttgggaagtgaacccatcatctcccgaaattcttcccacagtcctctgaggacagaa
tatgcaatcccttggctgaacgagcctagtttcgtgtttgctgacgtgatccgaaaaagc
ccagacagccccgacggcgaggatgacagggtctacttcttcttcacggaggtgtctgtg
gagtatgagtttgtgttcagggtgctgatcccacggatagcaagagtgtgcaagggggac
cagggcggcctgaggaccttgcagaagaaatggacctccttcctgaaagcccgactcatc
tgctcccggccagacagcggcttggtcttcaatgtgctgcgggatgtcttcgtgctcagg
tccccgggcctgaaggtgcctgtgttctatgcactcttcaccccacagctgaacaacgtg
gggctgtcggcagtgtgcgcctacaacctgtccacagccgaggaggtcttctcccacggg
aagtacatgcagagcaccacagtggagcagtcccacaccaagtgggtgcgctataatggc
ccggtacccaagccgcggcctggagcgtgcatcgacagcgaggcacgggccgccaactac
accagctccttgaatttgccagacaagacgctgcagttcgttaaagaccaccctttgatg
gatgactcggtaaccccaatagacaacaggcccaggttaatcaagaaagatgtgaactac
acccagatcgtggtggaccggacccaggccctggatgggactgtctatgatgtcatgttt
gtcagcacagaccggggagctctgcacaaagccatcagcctcgagcacgctgttcacatc
atcgaggagacccagctcttccaggactttgagccagtccagaccctgctgctgtcttca
aagaagggcaacaggtttgtctatgctggctctaactcgggcgtggtccaggccccgctg
gccttctgtgggaagcacggcacctgcgaggactgtgtgctggcgcgggacccctactgc
gcctggagcccgcccacagcgacctgcgtggctctgcaccagaccgagagccccagcagg
ggtttgattcaggagatgagcggcgatgcttctgtgtgcccggataaaagtaaaggaagt
taccggcagcattttttcaagcacggtggcacagcggaactgaaatgctcccaaaaatcc
aacctggcccgggtcttttggaagttccagaatggcgtgttgaaggccgagagccccaag
tacggtcttatgggcagaaaaaacttgctcatcttcaacttgtcagaaggagacagtggg
gtgtaccagtgcctgtcagaggagagggttaagaacaaaacggtcttccaagtggtcgcc
aagcacgtcctggaagtgaaggtggttccaaagcccgtagtggcccccaccttgtcagtt
gttcagacagaaggtagtaggattgccaccaaagtgttggtggcatccacccaagggtct
tctcccccaaccccagccgtgcaggccacctcctccggggccatcacccttcctcccaag
cctgcgcccaccggcacatcctgcgaaccaaagatcgtcatcaacacggtcccccagctc
cactcggagaaaaccatgtatcttaagtccagcgacaaccgcctcctcatgtccctcttc
ctcttcttctttgttctcttcctctgcctctttttctacaactgctataagggatacctg
cccagacagtgcttgaaattccgctcggccctactaattgggaagaagaagcccaagtca
gatttctgtgaccgtgagcagagcctgaaggagacgttagtagagccagggagcttctcc
cagcagaatggggagcaccccaagccagccctggacaccggctatgagaccgagcaagac
accatcaccagcaaagtccccacggatagggaggactcacagaggatcgacgacctttct
gccagggacaagccctttgacgtcaagtgtgagctgaagttcgctgactcagacgcagat
ggagactga

DBGET integrated database retrieval system