KEGG   Homo sapiens (human): 10523Help
Entry
10523             CDS       T01001                                 

Gene name
CHERP, DAN16, SCAF6, SRA1
Definition
calcium homeostasis endoplasmic reticulum protein
Orthology
K12841  
calcium homeostasis endoplasmic reticulum protein
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    10523 (CHERP)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    10523 (CHERP)
 Complex B
    10523 (CHERP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 916 aa AA seqDB search
MEMPLPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKL
ALEQQQLICKQQTPELEPAATMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQE
QHLLALRQEQVTAAVAHAVEQQMQKLLEETQLDMNEFDNLLQPIIDTCTKDAISAGKNWM
FSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKV
VVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQSPALGLGQYQATLINEYS
SVVQPVQLAFQQQIQTLKTQHEEFVTSLAQQQQQQQQQQQQLQMPQMEAEVKATPPPPAP
PPAPAPAPAIPPTTQPDDSKPPIQMPGSSEYEAPGGVQDPAAAGPRGPGPHDQIPPNKPP
WFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAPW
NNQPDAAWNSQFEGPWNSQHEQPPWGGGQREPPFRMQRPPHFRGPFPPHQQHPQFNQPPH
PHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPAEMGPPHHHPGHRMPHPGINE
HPPWAGPQHPDFGPPPHGFNGQPPHMRRQGPPHINHDDPSLVPNVPYFDLPAGLMAPLVK
LEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAK
MRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSNSRSSKSSGSYSRSRSRSCSRSYSRSR
SRSRSRSRSSRSRSRSQSRSRSKSYSPGRRRRSRSRSPTPPSSAGLGSNSAPPIPDSRLG
EENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRN
KSYSFIARMKARDECK
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggagatgccgctgccccccgatgaccaggagcttcgaaatgtcatcgacaagctcgcc
cagttcgtggctcgcaatgggcccgagtttgagaagatgactatggagaagcagaaggac
aaccccaaattctcgtttcttttcggaggcgaattctacagttactacaagtgcaagctg
gcgctggagcagcagcagctcatctgcaagcagcagaccccggagctggagccagccgcc
accatgccacccctgccacagcccccgctggcccccgccgcgcccatcccgccggcccag
ggcgcgccatccatggacgagctcatccagcagagccagtggaacctccagcagcaggag
cagcacttgctggcgctcagacaggagcaagtgacagcggccgtggcccacgcggtggag
cagcagatgcagaagcttctggaggagacccagctagacatgaacgagtttgacaacctc
ctgcagcccatcatcgacacgtgcaccaaggacgccatctcggccgggaagaactggatg
ttcagcaatgccaagtccccgccgcactgtgagctgatggccggccacctccggaaccgc
atcacggctgatggggcacacttcgagctgcggctgcacctcatctacctgatcaatgac
gtgctgcaccactgccagcgcaagcaggcccgggagctgctggccgccctgcagaaggtc
gtggtgcccatctactgcaccagcttcttggccgtggaggaagacaagcagcagaagatc
gcccggctcctgcagctctgggagaaaaacggctacttcgatgactccatcattcagcag
ctacagagcccagccctggggcttggtcagtaccaggccaccctcatcaacgagtactcc
tcagtggtccagccggtgcagctggccttccagcagcagatccagaccctcaagacgcag
cacgaggagtttgtcaccagcctggcccagcagcagcagcagcagcaacagcagcagcag
cagctccagatgccgcagatggaggctgaagtcaaggccacgcctccaccgcctgctcca
cccccggccccagcacctgcccctgccatcccgcccaccacccagcctgatgacagcaag
cctcccatccagatgcctggctcttcagagtacgaagctccaggaggggtccaggatcct
gcagctgccggcccccggggccccgggccacacgaccagatcccaccaaacaagccccct
tggtttgaccagcctcaccccgtggctccttggggccagcagcagccgccagagcagcca
ccctacccgcaccaccagggcggcccaccccactgccccccctggaacaacagccatgag
ggcatgtggggcgagcagcgcggtgaccccggctggaacggccagcgcgacgcgccctgg
aacaaccagcccgacgccgcctggaacagccagttcgagggcccctggaacagccagcac
gagcagccgccctggggcgggggccagcgcgagccacccttccgcatgcagcggccccca
cacttccgggggcccttcccgccccaccagcagcacccgcagttcaaccagcctccgcac
ccccacaacttcaaccgcttcccgccccgcttcatgcaggacgacttcccgccacggcac
cccttcgagcggccgccctatccccaccgcttcgactacccccagggggacttccctgcc
gaaatggggccccctcaccaccaccctggccaccgcatgcctcatcctggcatcaacgag
cacccgccttgggctggaccccagcaccctgacttcggccctcccccccatggcttcaac
gggcagcccccacacatgcggcgacagggcccaccccacatcaaccacgatgaccccagc
ctggtccccaatgtgccctacttcgatctccctgctgggctgatggcccccctcgtgaag
ctggaagatcacgagtacaagcctttggaccctaaagacatccgcctcccaccccccatg
ccgcccagcgagaggctgctggctgcagtggaggccttctacagccccccgtcccacgac
aggcccaggaacagtgaaggctgggagcagaacggcctctatgagttcttccgagcaaaa
atgcgggcccggcggaggaaaggccaggagaagaggaacagcggaccctcgaggtctcgg
agcagatccaagagtcgagggcgttcttcctcccgctccaactcaagatcctccaagtct
tcaggctcgtactcaaggtcaaggtcgcgctcctgctcccgttcctactcccgctccaga
tctagaagtcggagcaggtcgcgctcctccagaagccgctcccggtcccagtcgcggtcc
cggtccaagtcgtactccccaggaagaagacgccggtcacggtccaggagccccaccccg
ccttcctctgctggtctgggttctaattcggcgcctcccatccctgactcaaggctcgga
gaagagaacaaaggccatcagatgctggtgaagatgggctggagcggctcaggcggcctc
ggtgcgaaggagcaagggatccaggaccccatcaagggcggggacgtccgggataagtgg
gaccagtataaaggcgtgggcgtggctctggatgacccctatgagaactaccgcaggaac
aagagctactccttcatcgcccgcatgaaggccagggacgagtgtaagtag

DBGET integrated database retrieval system