KEGG   Homo sapiens (human): 10524Help
Entry
10524             CDS       T01001                                 

Gene name
KAT5, ESA1, HTATIP, HTATIP1, PLIP, TIP, TIP60, ZC2HC5, cPLA2
Definition
(RefSeq) lysine acetyltransferase 5
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    10524 (KAT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     10524 (KAT5)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    10524 (KAT5)
   HAT complexes
    TIP60 complex
     10524 (KAT5)
    NuA4 complex
     10524 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q92993(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 513 aa AA seqDB search
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggtgggggagataatcgagggctgccgcctacccgtgctgcggcggaaccag
gacaacgaagatgagtggcccctggccgagatcctgagcgtgaaggacatcagtggccgg
aagcttttctacgtccattacattgacttcaacaaacgtctggatgaatgggtgacgcat
gagcggctggacctaaagaagatccagttccccaagaaagaggccaagacccccactaag
aacggacttcctgggtcccgtcctggctctccagagagagaggtgccggcctcggcgcag
gccagcgggaagaccttgccaatcccggtccagatcacactccgcttcaacctgcccaag
gagcgggaggccattcccggtggcgagcctgaccagccgctctcctccagctcctgcctg
cagcccaaccaccgctcaacgaaacggaaggtggaggtggtttcaccagcaactccagtg
cccagcgagacagccccggcctcggtttttccccagaatggagccgcccgtagggcagtg
gcagcccagccaggacggaagcgaaaatcgaattgtttgggcactgatgaggactcccag
gacagctctgatggaataccgtcagcaccacgcatgactggcagcctggtgtctgatcga
agccacgacgacatcgtcacccggatgaagaacattgagtgcattgagctgggccggcac
cgcctcaagccgtggtacttctccccgtacccacaggaactcaccacattgcctgtcctc
tacctgtgcgagttctgcctcaagtacggccgtagtctcaagtgtcttcagcgtcatttg
accaagtgtgacctacgacatcctccaggcaatgagatttaccgcaagggcaccatctcc
ttctttgagattgatggacgtaagaacaagagttattcccagaacctgtgtcttttggcc
aagtgtttccttgaccataagacactgtactatgacacagaccctttcctcttctacgtc
atgacagagtatgactgtaagggcttccacatcgtgggctacttctccaaggagaaagaa
tcaacggaagactacaatgtggcctgcatcctaaccctgcctccctaccagcgccggggc
tacggcaagctgctgatcgagttcagctatgaactctccaaagtggaagggaaaacaggg
acccctgagaagcccctctcagaccttggcctcctatcctatcgaagctactggtcccag
accatcctggagatcctgatggggctgaagtcggagagcggggagaggccacagatcacc
atcaatgagattagtgaaatcaccagcatcaagaaggaggatgtcatctccactctgcag
tacctcaatctcatcaactactacaagggccagtacatcctcacactgtcagaggacatc
gtggatggccatgagcgggccatgctcaagcggctcctgcggatcgactccaagtgtctg
cacttcactcccaaggactggagcaagagggggaagtggtga

DBGET integrated database retrieval system