KEGG   Homo sapiens (human): 1056Help
Entry
1056              CDS       T01001                                 

Gene name
CEL, BAL, BSDL, BSSL, CELL, CEase, FAP, FAPP, LIPA, MODY8
Definition
carboxyl ester lipase (EC:3.1.1.13 3.1.1.3)
Orthology
K12298  
bile salt-stimulated lipase [EC:3.1.1.3 3.1.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid biosynthesis
Glycerolipid metabolism
Metabolic pathways
Pancreatic secretion
Fat digestion and absorption
Module
Acylglycerol degradation
Disease
H00410  
Maturity onset diabetes of the young (MODY)
Drug target
Orlistat: 
Class
Metabolism; Lipid metabolism; Steroid biosynthesis [PATH:hsa00100]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 756 aa AA seqDB search
MLTMGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAA
PTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRD
LPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDAN
LPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAI
SQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGL
EYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNK
KVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPT
EIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQD
RTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTN
FLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTG
DSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAP
PVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPT
GDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccatggggcgcctgcaactggttgtgttgggcctcacctgctgctgggcagtg
gcgagtgccgcgaagctgggcgccgtgtacacagaaggtgggttcgtggaaggcgtcaat
aagaagctcggcctcctgggtgactctgtggacatcttcaagggcatccccttcgcagct
cccaccaaggccctggaaaatcctcagccacatcctggctggcaagggaccctgaaggcc
aagaacttcaagaagagatgcctgcaggccaccatcacccaggacagcacctacggggat
gaagactgcctgtacctcaacatttgggtgccccagggcaggaagcaagtctcccgggac
ctgcccgttatgatctggatctatggaggcgccttcctcatggggtccggccatggggcc
aacttcctcaacaactacctgtatgacggcgaggagatcgccacacgcggaaacgtcatc
gtggtcaccttcaactaccgtgtcggcccccttgggttcctcagcactggggacgccaat
ctgccaggtaactatggccttcgggatcagcacatggccattgcttgggtgaagaggaat
atcgcggccttcgggggggaccccaacaacatcacgctcttcggggagtctgctggaggt
gccagcgtctctctgcagaccctctccccctacaacaagggcctcatccggcgagccatc
agccagagcggcgtggccctgagtccctgggtcatccagaaaaacccactcttctgggcc
aaaaaggtggctgagaaggtgggttgccctgtgggtgatgccgccaggatggcccagtgt
ctgaaggttactgatccccgagccctgacgctggcctataaggtgccgctggcaggcctg
gagtaccccatgctgcactatgtgggcttcgtccctgtcattgatggagacttcatcccc
gctgacccgatcaacctgtacgccaacgccgccgacatcgactatatagcaggcaccaac
aacatggacggccacatcttcgccagcatcgacatgcctgccatcaacaagggcaacaag
aaagtcacggaggaggacttctacaagctggtcagtgagttcacaatcaccaaggggctc
agaggcgccaagacgacctttgatgtctacaccgagtcctgggcccaggacccatcccag
gagaataagaagaagactgtggtggactttgagaccgatgtcctcttcctggtgcccacc
gagattgccctagcccagcacagagccaatgccaagagtgccaagacctacgcctacctg
ttttcccatccctctcggatgcccgtctaccccaaatgggtgggggccgaccatgcagat
gacattcagtacgttttcgggaagcccttcgccacccccacgggctaccggccccaagac
aggacagtctctaaggccatgatcgcctactggaccaactttgccaaaacaggggacccc
aacatgggcgactcggctgtgcccacacactgggaaccctacactacggaaaacagcggc
tacctggagatcaccaagaagatgggcagcagctccatgaagcggagcctgagaaccaac
ttcctgcgctactggaccctcacctatctggcgctgcccacagtgaccgaccaggaggcc
acccctgtgccccccacaggggactccgaggccactcccgtgccccccacgggtgactcc
gagaccgcccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggt
gactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccgccc
acgggtgactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtg
ccgcccacgggtgactccggggccccccccgtgccgcccacgggtgactccggggccccc
cccgtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgacgccggg
cccccccccgtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgac
tccggggccccccccgtgacccccacgggtgactccgagaccgcccccgtgccgcccacg
ggtgactccggggccccccctgtgccccccacgggtgactctgaggctgcccctgtgccc
cccacagatgactccaaggaagctcagatgcctgcagtcattaggttttag

DBGET integrated database retrieval system