KEGG   Homo sapiens (human): 1056Help
Entry
1056              CDS       T01001                                 

Gene name
CEL, BAL, BSDL, BSSL, CELL, CEase, FAP, FAPP, LIPA, MODY8
Definition
(RefSeq) carboxyl ester lipase
  KO
K12298  bile salt-stimulated lipase [EC:3.1.1.3 3.1.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa04972  Pancreatic secretion
hsa04975  Fat digestion and absorption
Module
hsa_M00098  Acylglycerol degradation
Disease
H00410  Maturity onset diabetes of the young (MODY)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    1056 (CEL)
   00561 Glycerolipid metabolism
    1056 (CEL)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    1056 (CEL)
   04975 Fat digestion and absorption
    1056 (CEL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     1056 (CEL)
    3.1.1.13  sterol esterase
     1056 (CEL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   1056 (CEL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Mucin-like Abhydrolase_3 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 1056
NCBI-ProteinID: NP_001798
OMIM: 114840
HGNC: 1848
Ensembl: ENSG00000170835
Vega: OTTHUMG00000020855
UniProt: X6R868 O75612 B4DSX9 Q86SR3
Structure
PDB: 

Jmol
Position
9q34.13
AA seq 756 aa AA seqDB search
MLTMGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAA
PTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRD
LPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDAN
LPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAI
SQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGL
EYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNK
KVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPT
EIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQD
RTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTN
FLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTG
DSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAP
PVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPT
GDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccatggggcgcctgcaactggttgtgttgggcctcacctgctgctgggcagtg
gcgagtgccgcgaagctgggcgccgtgtacacagaaggtgggttcgtggaaggcgtcaat
aagaagctcggcctcctgggtgactctgtggacatcttcaagggcatccccttcgcagct
cccaccaaggccctggaaaatcctcagccacatcctggctggcaagggaccctgaaggcc
aagaacttcaagaagagatgcctgcaggccaccatcacccaggacagcacctacggggat
gaagactgcctgtacctcaacatttgggtgccccagggcaggaagcaagtctcccgggac
ctgcccgttatgatctggatctatggaggcgccttcctcatggggtccggccatggggcc
aacttcctcaacaactacctgtatgacggcgaggagatcgccacacgcggaaacgtcatc
gtggtcaccttcaactaccgtgtcggcccccttgggttcctcagcactggggacgccaat
ctgccaggtaactatggccttcgggatcagcacatggccattgcttgggtgaagaggaat
atcgcggccttcgggggggaccccaacaacatcacgctcttcggggagtctgctggaggt
gccagcgtctctctgcagaccctctccccctacaacaagggcctcatccggcgagccatc
agccagagcggcgtggccctgagtccctgggtcatccagaaaaacccactcttctgggcc
aaaaaggtggctgagaaggtgggttgccctgtgggtgatgccgccaggatggcccagtgt
ctgaaggttactgatccccgagccctgacgctggcctataaggtgccgctggcaggcctg
gagtaccccatgctgcactatgtgggcttcgtccctgtcattgatggagacttcatcccc
gctgacccgatcaacctgtacgccaacgccgccgacatcgactatatagcaggcaccaac
aacatggacggccacatcttcgccagcatcgacatgcctgccatcaacaagggcaacaag
aaagtcacggaggaggacttctacaagctggtcagtgagttcacaatcaccaaggggctc
agaggcgccaagacgacctttgatgtctacaccgagtcctgggcccaggacccatcccag
gagaataagaagaagactgtggtggactttgagaccgatgtcctcttcctggtgcccacc
gagattgccctagcccagcacagagccaatgccaagagtgccaagacctacgcctacctg
ttttcccatccctctcggatgcccgtctaccccaaatgggtgggggccgaccatgcagat
gacattcagtacgttttcgggaagcccttcgccacccccacgggctaccggccccaagac
aggacagtctctaaggccatgatcgcctactggaccaactttgccaaaacaggggacccc
aacatgggcgactcggctgtgcccacacactgggaaccctacactacggaaaacagcggc
tacctggagatcaccaagaagatgggcagcagctccatgaagcggagcctgagaaccaac
ttcctgcgctactggaccctcacctatctggcgctgcccacagtgaccgaccaggaggcc
acccctgtgccccccacaggggactccgaggccactcccgtgccccccacgggtgactcc
gagaccgcccccgtgccgcccacgggtgactccggggccccccccgtgccgcccacgggt
gactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtgccgccc
acgggtgactccggggccccccccgtgccgcccacgggtgactccggggccccccccgtg
ccgcccacgggtgactccggggccccccccgtgccgcccacgggtgactccggggccccc
cccgtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgacgccggg
cccccccccgtgccgcccacgggtgactccggcgccccccccgtgccgcccacgggtgac
tccggggccccccccgtgacccccacgggtgactccgagaccgcccccgtgccgcccacg
ggtgactccggggccccccctgtgccccccacgggtgactctgaggctgcccctgtgccc
cccacagatgactccaaggaagctcagatgcctgcagtcattaggttttag

DBGET integrated database retrieval system