KEGG   Homo sapiens (human): 10645Help
Entry
10645             CDS       T01001                                 

Gene name
CAMKK2, CAMKK, CAMKKB
Definition
(RefSeq) calcium/calmodulin dependent protein kinase kinase 2
  KO
K07359  
calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
Autophagy - animal
AMPK signaling pathway
Longevity regulating pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    10645 (CAMKK2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    10645 (CAMKK2)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    10645 (CAMKK2)
   04921 Oxytocin signaling pathway
    10645 (CAMKK2)
  Aging
   04211 Longevity regulating pathway - mammal
    10645 (CAMKK2)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    10645 (CAMKK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     10645 (CAMKK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  CAMKK family
   10645 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96RR4(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 588 aa AA seqDB search
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgtgtctctagccagcccagcagcaaccgggccgccccccaggatgagctg
gggggcaggggcagcagcagcagcgaaagccagaagccctgtgaggccctgcggggcctc
tcatccttgagcatccacctgggcatggagtccttcattgtggtcaccgagtgtgagccg
ggctgtgctgtggacctcggcttggcgcgggaccggcccctggaggccgatggccaagag
gtcccccttgacacctccgggtcccaggcccggccccacctctccggtcgcaagctgtct
ctgcaagagcggtcccagggtgggctggcagccggtggcagcctggacatgaacggacgc
tgcatctgcccgtccctgccctactcacccgtcagctccccgcagtcctcgcctcggctg
ccccggcggccgacagtggagtctcaccacgtctccatcacgggtatgcaggactgtgtg
cagctgaatcagtataccctgaaggatgaaattggaaagggctcctatggtgtcgtcaag
ttggcctacaatgaaaatgacaatacctactatgcaatgaaggtgctgtccaaaaagaag
ctgatccggcaggccggctttccacgtcgccctccaccccgaggcacccggccagctcct
ggaggctgcatccagcccaggggccccattgagcaggtgtaccaggaaattgccatcctc
aagaagctggaccaccccaatgtggtgaagctggtggaggtcctggatgaccccaatgag
gaccatctgtacatggtgttcgaactggtcaaccaagggcccgtgatggaagtgcccacc
ctcaaaccactctctgaagaccaggcccgtttctacttccaggatctgatcaaaggcatc
gagtacttacactaccagaagatcatccaccgtgacatcaaaccttccaacctcctggtc
ggagaagatgggcacatcaagatcgctgactttggtgtgagcaatgaattcaagggcagt
gacgcgctcctctccaacaccgtgggcacgcccgccttcatggcacccgagtcgctctct
gagacccgcaagatcttctctgggaaggccttggatgtttgggccatgggtgtgacacta
tactgctttgtctttggccagtgcccattcatggacgagcggatcatgtgtttacacagt
aagatcaagagtcaggccctggaatttccagaccagcccgacatagctgaggacttgaag
gacctgatcacccgtatgctggacaagaaccccgagtcgaggatcgtggtgccggaaatc
aagctgcacccctgggtcacgaggcatggggcggagccgttgccgtcggaggatgagaac
tgcacgctggtcgaagtgactgaagaggaggtcgagaactcagtcaaacacattcccagc
ttggcaaccgtgatcctggtgaagaccatgatacgtaaacgctcctttgggaacccattc
gagggcagccggcgggaggaacgctcactgtcagcgcctggaaacttgctcaccaaaaaa
ccaaccagggaatgtgagtccctgtctgagctcaaggaagcaaggcagcgaagacaacct
ccagggcaccgacccgccccccgtgggggaggaggaagtgctcttgtgagaggcagtccc
tgcgtggaaagttgctgggcccccgcccccggctcccccgcacgcatgcatccactgcgg
ccggaggaggccatggagcccgagtag

DBGET integrated database retrieval system