KEGG   Homo sapiens (human): 10645Help
Entry
10645             CDS       T01001                                 

Gene name
CAMKK2, CAMKK, CAMKKB
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2 (EC:2.7.11.17)
  KO
K07359  
calcium/calmodulin-dependent protein kinase kinase [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Longevity regulating pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    10645 (CAMKK2)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    10645 (CAMKK2)
   04921 Oxytocin signaling pathway
    10645 (CAMKK2)
  Aging
   04211 Longevity regulating pathway - mammal
    10645 (CAMKK2)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    10645 (CAMKK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     10645 (CAMKK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  CAMKK family
   10645 (CAMKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.2
AA seq 588 aa AA seqDB search
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEP
GCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGR
CICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVK
LAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAIL
KKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGI
EYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLS
ETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPS
LATVILVKTMIRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQP
PGHRPAPRGGGGSALVRGSPCVESCWAPAPGSPARMHPLRPEEAMEPE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatgtgtctctagccagcccagcagcaaccgggccgccccccaggatgagctg
gggggcaggggcagcagcagcagcgaaagccagaagccctgtgaggccctgcggggcctc
tcatccttgagcatccacctgggcatggagtccttcattgtggtcaccgagtgtgagccg
ggctgtgctgtggacctcggcttggcgcgggaccggcccctggaggccgatggccaagag
gtcccccttgacacctccgggtcccaggcccggccccacctctccggtcgcaagctgtct
ctgcaagagcggtcccagggtgggctggcagccggtggcagcctggacatgaacggacgc
tgcatctgcccgtccctgccctactcacccgtcagctccccgcagtcctcgcctcggctg
ccccggcggccgacagtggagtctcaccacgtctccatcacgggtatgcaggactgtgtg
cagctgaatcagtataccctgaaggatgaaattggaaagggctcctatggtgtcgtcaag
ttggcctacaatgaaaatgacaatacctactatgcaatgaaggtgctgtccaaaaagaag
ctgatccggcaggccggctttccacgtcgccctccaccccgaggcacccggccagctcct
ggaggctgcatccagcccaggggccccattgagcaggtgtaccaggaaattgccatcctc
aagaagctggaccaccccaatgtggtgaagctggtggaggtcctggatgaccccaatgag
gaccatctgtacatggtgttcgaactggtcaaccaagggcccgtgatggaagtgcccacc
ctcaaaccactctctgaagaccaggcccgtttctacttccaggatctgatcaaaggcatc
gagtacttacactaccagaagatcatccaccgtgacatcaaaccttccaacctcctggtc
ggagaagatgggcacatcaagatcgctgactttggtgtgagcaatgaattcaagggcagt
gacgcgctcctctccaacaccgtgggcacgcccgccttcatggcacccgagtcgctctct
gagacccgcaagatcttctctgggaaggccttggatgtttgggccatgggtgtgacacta
tactgctttgtctttggccagtgcccattcatggacgagcggatcatgtgtttacacagt
aagatcaagagtcaggccctggaatttccagaccagcccgacatagctgaggacttgaag
gacctgatcacccgtatgctggacaagaaccccgagtcgaggatcgtggtgccggaaatc
aagctgcacccctgggtcacgaggcatggggcggagccgttgccgtcggaggatgagaac
tgcacgctggtcgaagtgactgaagaggaggtcgagaactcagtcaaacacattcccagc
ttggcaaccgtgatcctggtgaagaccatgatacgtaaacgctcctttgggaacccattc
gagggcagccggcgggaggaacgctcactgtcagcgcctggaaacttgctcaccaaaaaa
ccaaccagggaatgtgagtccctgtctgagctcaaggaagcaaggcagcgaagacaacct
ccagggcaccgacccgccccccgtgggggaggaggaagtgctcttgtgagaggcagtccc
tgcgtggaaagttgctgggcccccgcccccggctcccccgcacgcatgcatccactgcgg
ccggaggaggccatggagcccgagtag

DBGET integrated database retrieval system