KEGG   Homo sapiens (human): 10663Help
Entry
10663             CDS       T01001                                 

Gene name
CXCR6, BONZO, CD186, STRL33, TYMSTR
Definition
chemokine (C-X-C motif) receptor 6
Orthology
K04191  
C-X-C chemokine receptor type 6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21
AA seq 342 aa AA seqDB search
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH
KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL
TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC
GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF
LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcatgattaccatgaagactatgggttcagcagtttcaatgacagcagccag
gaggagcatcaagacttcctgcagttcagcaaggtctttctgccctgcatgtacctggtg
gtgtttgtctgtggtctggtggggaactctctggtgctggtcatatccatcttctaccat
aagttgcagagcctgacggatgtgttcctggtgaacctacccctggctgacctggtgttt
gtctgcactctgcccttctgggcctatgcaggcatccatgaatgggtgtttggccaggtc
atgtgcaagagcctactgggcatctacactattaacttctacacgtccatgctcatcctc
acctgcatcactgtggatcgtttcattgtagtggttaaggccaccaaggcctacaaccag
caagccaagaggatgacctggggcaaggtcaccagcttgctcatctgggtgatatccctg
ctggtttccttgccccaaattatctatggcaatgtctttaatctcgacaagctcatatgt
ggttaccatgacgaggcaatttccactgtggttcttgccacccagatgacactggggttc
ttcttgccactgctcaccatgattgtctgctattcagtcataatcaaaacactgcttcat
gctggaggcttccagaagcacagatctctaaagatcatcttcctggtgatggctgtgttc
ctgctgacccagatgcccttcaacctcatgaagttcatccgcagcacacactgggaatac
tatgccatgaccagctttcactacaccatcatggtgacagaggccatcgcatacctgagg
gcctgccttaaccctgtgctctatgcctttgtcagcctgaagtttcgaaagaacttctgg
aaacttgtgaaggacattggttgcctcccttaccttggggtctcacatcaatggaaatct
tctgaggacaattccaagactttttctgcctcccacaatgtggaggccaccagcatgttc
cagttatag

DBGET integrated database retrieval system