KEGG   Homo sapiens (human): 10663Help
Entry
10663             CDS       T01001                                 

Gene name
CXCR6, BONZO, CD186, STRL33, TYMSTR
Definition
chemokine (C-X-C motif) receptor 6
Orthology
K04191  
C-X-C chemokine receptor type 6
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10663 (CXCR6)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    10663 (CXCR6)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CXC Chemokine
    10663 (CXCR6)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   10663 (CXCR6)
Cellular antigens [BR:hsa04090]
 Proteins
  10663 (CXCR6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21
AA seq 342 aa AA seqDB search
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH
KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL
TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC
GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF
LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW
KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcagagcatgattaccatgaagactatgggttcagcagtttcaatgacagcagccag
gaggagcatcaagacttcctgcagttcagcaaggtctttctgccctgcatgtacctggtg
gtgtttgtctgtggtctggtggggaactctctggtgctggtcatatccatcttctaccat
aagttgcagagcctgacggatgtgttcctggtgaacctacccctggctgacctggtgttt
gtctgcactctgcccttctgggcctatgcaggcatccatgaatgggtgtttggccaggtc
atgtgcaagagcctactgggcatctacactattaacttctacacgtccatgctcatcctc
acctgcatcactgtggatcgtttcattgtagtggttaaggccaccaaggcctacaaccag
caagccaagaggatgacctggggcaaggtcaccagcttgctcatctgggtgatatccctg
ctggtttccttgccccaaattatctatggcaatgtctttaatctcgacaagctcatatgt
ggttaccatgacgaggcaatttccactgtggttcttgccacccagatgacactggggttc
ttcttgccactgctcaccatgattgtctgctattcagtcataatcaaaacactgcttcat
gctggaggcttccagaagcacagatctctaaagatcatcttcctggtgatggctgtgttc
ctgctgacccagatgcccttcaacctcatgaagttcatccgcagcacacactgggaatac
tatgccatgaccagctttcactacaccatcatggtgacagaggccatcgcatacctgagg
gcctgccttaaccctgtgctctatgcctttgtcagcctgaagtttcgaaagaacttctgg
aaacttgtgaaggacattggttgcctcccttaccttggggtctcacatcaatggaaatct
tctgaggacaattccaagactttttctgcctcccacaatgtggaggccaccagcatgttc
cagttatag

DBGET integrated database retrieval system