KEGG   Homo sapiens (human): 10666Help
Entry
10666             CDS       T01001                                 

Gene name
CD226, DNAM-1, DNAM1, PTA1, TLiSA1
Definition
(RefSeq) CD226 molecule
  KO
K06567  CD226 antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Disease
H00408  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    10666 (CD226)
CD molecules [BR:hsa04090]
 Proteins
  10666 (CD226)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 Ig_2 I-set ig Izumo-Ig Herpes_gE Ac110_PIF
Motif
Other DBs
NCBI-GeneID: 10666
NCBI-ProteinID: NP_001290547
OMIM: 605397
HGNC: 16961
Ensembl: ENSG00000150637
Vega: OTTHUMG00000132809
Pharos: Q15762(Tbio)
UniProt: Q15762
Position
18q22.2
AA seq 336 aa AA seqDB search
MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSI
AIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQK
VIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCN
LVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTV
AEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNY
RSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggattatcctactttacttttggctcttcttcatgtatacagagctctatgtgaagag
gtgctttggcatacatcagttccctttgccgagaacatgtctctagaatgtgtgtatcca
tcaatgggcatcttaacacaggtggagtggttcaagatcgggacccagcaggattccata
gccattttcagccctactcatggcatggtcataaggaagccctatgctgagagggtttac
tttttgaattcaacgatggcttccaataacatgactcttttctttcggaatgcctctgaa
gatgatgttggctactattcctgctctctttacacttacccacagggaacttggcagaag
gtgatacaggtggttcagtcagatagttttgaggcagctgtgccatcaaatagccacatt
gtttcggaacctggaaagaatgtcacactcacttgtcagcctcagatgacgtggcctgtg
caggcagtgaggtgggaaaagatccagccccgtcagatcgacctcttaacttactgcaac
ttggtccatggcagaaatttcacctccaagttcccaagacaaatagtgagcaactgcagc
cacggaaggtggagcgtcatcgtcatccccgatgtcacagtctcagactcggggctttac
cgctgctacttgcaggccagcgcaggagaaaacgaaaccttcgtgatgagattgactgta
gccgagggtaaaaccgataaccaatataccctctttgtggctggagggacagttttattg
ttgttgtttgttatctcaattaccaccatcattgtcattttccttaacagaaggagaagg
agagagagaagagatctatttacagagtcctgggatacacagaaggcacccaataactat
agaagtcccatctctaccagtcaacctaccaatcaatccatggatgatacaagagaggat
atttatgtcaactatccaaccttctctcgcagaccaaagactagagtttaa

DBGET integrated database retrieval system