KEGG   Homo sapiens (human): 10673Help
Entry
10673             CDS       T01001                                 

Gene name
TNFSF13B, BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, ZTNF4
Definition
tumor necrosis factor (ligand) superfamily, member 13b
Orthology
K05476  
tumor necrosis factor ligand superfamily member 13B
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Intestinal immune network for IgA production
Rheumatoid arthritis
Drug target
Belimumab: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    10673 (TNFSF13B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10673 (TNFSF13B)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    10673 (TNFSF13B)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    10673 (TNFSF13B)
Cellular antigens [BR:hsa04090]
 Proteins
  10673 (TNFSF13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q32-q34
AA seq 266 aa AA seqDB search
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCC
LTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
GEGNSSQNSRNKRAVQGPEETGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQV
LYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDEL
QLAIPRENAQISLDGDVTFFGALKLL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggatgactccacagaaagggagcagtcacgccttacttcttgccttaagaaaagagaa
gaaatgaaactgaaggagtgtgtttccatcctcccacggaaggaaagcccctctgtccga
tcctccaaagacggaaagctgctggctgcaaccttgctgctggcactgctgtcttgctgc
ctcacggtggtgtctttctaccaggtggccgccctgcaaggggacctggccagcctccgg
gcagagctgcagggccaccacgcggagaagctgccagcaggagcaggagcccccaaggcc
ggcctggaggaagctccagctgtcaccgcgggactgaaaatctttgaaccaccagctcca
ggagaaggcaactccagtcagaacagcagaaataagcgtgccgttcagggtccagaagaa
acaggatcttacacatttgttccatggcttctcagctttaaaaggggaagtgccctagaa
gaaaaagagaataaaatattggtcaaagaaactggttacttttttatatatggtcaggtt
ttatatactgataagacctacgccatgggacatctaattcagaggaagaaggtccatgtc
tttggggatgaattgagtctggtgactttgtttcgatgtattcaaaatatgcctgaaaca
ctacccaataattcctgctattcagctggcattgcaaaactggaagaaggagatgaactc
caacttgcaataccaagagaaaatgcacaaatatcactggatggagatgtcacatttttt
ggtgcattgaaactgctgtga

DBGET integrated database retrieval system