KEGG   Homo sapiens (human): 10673Help
Entry
10673             CDS       T01001                                 

Gene name
TNFSF13B, BAFF, BLYS, CD257, DTL, TALL-1, TALL1, THANK, TNFSF20, TNLG7A, ZTNF4
Definition
(RefSeq) TNF superfamily member 13b
  KO
K05476  tumor necrosis factor ligand superfamily member 13B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05323  Rheumatoid arthritis
Drug target
Atacicept: D09704
Belimumab: D03068
Briobacept: D08877
Tabalumab: D10083
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    10673 (TNFSF13B)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10673 (TNFSF13B)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    10673 (TNFSF13B)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    10673 (TNFSF13B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   10673 (TNFSF13B)
CD molecules [BR:hsa04090]
 Proteins
  10673 (TNFSF13B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 10673
NCBI-ProteinID: NP_006564
OMIM: 603969
HGNC: 11929
Ensembl: ENSG00000102524
Vega: OTTHUMG00000017329
Pharos: Q9Y275(Tclin)
UniProt: Q9Y275 A0A0U5J7Q1
Structure
PDB: 

Jmol
Position
13q33.3
AA seq 285 aa AA seqDB search
MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCC
LTVVSFYQVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP
GEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEE
KENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETL
PNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggatgactccacagaaagggagcagtcacgccttacttcttgccttaagaaaagagaa
gaaatgaaactgaaggagtgtgtttccatcctcccacggaaggaaagcccctctgtccga
tcctccaaagacggaaagctgctggctgcaaccttgctgctggcactgctgtcttgctgc
ctcacggtggtgtctttctaccaggtggccgccctgcaaggggacctggccagcctccgg
gcagagctgcagggccaccacgcggagaagctgccagcaggagcaggagcccccaaggcc
ggcctggaggaagctccagctgtcaccgcgggactgaaaatctttgaaccaccagctcca
ggagaaggcaactccagtcagaacagcagaaataagcgtgccgttcagggtccagaagaa
acagtcactcaagactgcttgcaactgattgcagacagtgaaacaccaactatacaaaaa
ggatcttacacatttgttccatggcttctcagctttaaaaggggaagtgccctagaagaa
aaagagaataaaatattggtcaaagaaactggttacttttttatatatggtcaggtttta
tatactgataagacctacgccatgggacatctaattcagaggaagaaggtccatgtcttt
ggggatgaattgagtctggtgactttgtttcgatgtattcaaaatatgcctgaaacacta
cccaataattcctgctattcagctggcattgcaaaactggaagaaggagatgaactccaa
cttgcaataccaagagaaaatgcacaaatatcactggatggagatgtcacattttttggt
gcattgaaactgctgtga

DBGET integrated database retrieval system