KEGG   Homo sapiens (human): 10718Help
Entry
10718             CDS       T01001                                 

Gene name
NRG3, HRG3, pro-NRG3
Definition
(RefSeq) neuregulin 3
  KO
K05457  neuregulin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    10718 (NRG3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   10718 (NRG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neuregulin EGF Laminin_EGF LapA_dom DUF3021 EGF_2
Motif
Other DBs
NCBI-GeneID: 10718
NCBI-ProteinID: NP_001010848
OMIM: 605533
HGNC: 7999
Ensembl: ENSG00000185737
Vega: OTTHUMG00000018626
Pharos: P56975(Tbio)
UniProt: P56975 B9EGV5
Position
10q23.1
AA seq 696 aa AA seqDB search
MSEGAAAASPPGAASAAAASAEEGTAAAAAAAAAGGGPDGGGEGAAEPPRELRCSDCIVW
NRQQTWLCVVPLFIGFIGLGLSLMLLKWIVVGSVKEYVPTDLVDSKGMGQDPFFLSKPSS
FPKAMETTTTTTSTTSPATPSAGGAASSRTPNRISTRLTTITRAPTRFPGHRVPIRASPR
STTARNTAAPATVPSTTAPFFSSSTLGSRPPVPGTPSTQAMPSWPTAAYATSSYLHDSTP
SWTLSPFQDAASSSSSSSSSATTTTPETSTSPKFHTTTYSTERSEHFKPCRDKDLAYCLN
DGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDPTDHLGIEFMESEEVYQRQ
VLSISCIIFGIVIVGMFCAAFYFKSKKQAKQIQEQLKVPQNGKSYSLKASSTMAKSENLV
KSHVQLQNYSKVERHPVTALEKMMESSFVGPQSFPEVPSPDRGSQSVKHHRSLSSCCSPG
QRSGMLHRNAFRRTPPSPRSRLGGIVGPAYQQLEESRIPDQDTIPCQGYSSSGLKTQRNT
SINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPSVGLEETCLQMPGISEVKSIKW
CKNSYSADVVNVSIPVSDCLIAEQQEVKILLETVQEQIRILTDARRSEDYELASVETEDS
ASENTAFLPLSPTAKSEREAQFVLRNEIQRDSALTK
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaggggcggccgctgcctcgccacctggtgccgcttcggcagccgccgcctcg
gccgaggagggcaccgcggcggctgcggcggcggcagcggcgggcgggggcccggacggc
ggcggcgaaggggcggccgagcccccccgggagttacgctgtagcgactgcatcgtgtgg
aaccggcagcagacgtggctgtgcgtggtacctctgttcatcggcttcatcggcctgggg
ctcagcctcatgcttctcaaatggatcgtggtgggctccgtcaaggagtacgtgcccacc
gacctagtggactccaaggggatgggccaggaccccttcttcctctccaagcccagctct
ttccccaaggccatggagaccaccaccactaccacttccaccacgtcccccgccaccccc
tccgccgggggtgccgcctcctccaggacgcccaaccggattagcactcgcctgaccacc
atcacgcgggcgcccactcgcttccccgggcaccgggtgcccatccgggccagcccgcgc
tccaccacagcacggaacactgcggcccctgcgacggtcccgtccaccacggccccgttc
ttcagtagcagcacgctgggctcccgacccccggtgccaggaactccaagtacccaggca
atgccctcctggcctactgcggcatacgctacctcctcctaccttcacgattctactccc
tcctggaccctgtctccctttcaggatgctgcctcctcttcttcctcttcttcctcctcc
gctaccaccaccacaccagaaactagcaccagccccaaatttcatacgacgacatattcc
acagagcgatccgagcacttcaaaccctgccgagacaaggaccttgcatactgtctcaat
gatggcgagtgctttgtgatcgaaaccctgaccggatcccataaacactgtcggtgcaaa
gaaggctaccaaggagtccgttgtgatcaatttctgccgaaaactgattccatcttatcg
gatccaacagaccacttggggattgaattcatggagagtgaagaagtttatcaaaggcag
gtgctgtcaatttcatgtatcatctttggaattgtcatcgtgggcatgttctgtgcagca
ttctacttcaaaagcaagaaacaagctaaacaaatccaagagcagctgaaagtgccacaa
aatggtaaaagctacagtctcaaagcatccagcacaatggcaaagtcagagaacttggtg
aagagccatgtccagctgcaaaattattcaaaggtggaaaggcatcctgtgactgcattg
gagaaaatgatggagtcaagttttgtcggcccccagtcattccctgaggtcccttctcct
gacagaggaagccagtctgtcaaacaccacaggagtctatcctcttgctgcagcccaggg
caaagaagtggcatgctccataggaatgccttcagaaggacacccccgtcaccccgaagt
aggctaggtggaattgtgggaccagcatatcagcaactcgaagaatcaaggatcccagac
caggatacgataccttgccaagggtattcatccagtggtttaaaaacccaacgaaataca
tcaataaatatgcaactgccttcaagagagacaaacccctattttaatagcttggagcaa
aaggacctggtgggctattcatccacaagggccagttctgtgcccatcatcccttcagtg
ggtttagaggaaacctgcctgcaaatgccagggatttctgaagtcaaaagcatcaaatgg
tgcaaaaactcctattcagctgacgttgtcaatgtgagtattccagtcagcgattgtctt
atagcagaacaacaagaagtgaaaatattgctagaaactgtccaggagcagatccgaatt
ctgactgatgccagacggtcagaagactacgaactggccagcgtagaaaccgaggacagt
gcaagcgaaaacacagcctttctccccctgagtcccacagccaaatcagaacgagaggcg
caatttgtcttaagaaatgaaatacaaagagactctgcattgaccaagtga

DBGET integrated database retrieval system