KEGG   Homo sapiens (human): 1072Help
Entry
1072              CDS       T01001                                 

Gene name
CFL1, CFL, HEL-S-15
Definition
cofilin 1 (non-muscle)
Orthology
K05765  
cofilin
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Pertussis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1072 (CFL1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    1072 (CFL1)
  Development
   04360 Axon guidance
    1072 (CFL1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    1072 (CFL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1072 (CFL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 166 aa AA seqDB search
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtgtggctgtctctgatggtgtcatcaaggtgttcaacgacatgaaggtg
cgtaagtcttcaacgccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg
agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgatgtg
ggccagactgtcgacgacccctacgccacctttgtcaagatgctgccagataaggactgc
cgctatgccctctatgatgcaacctatgagaccaaggagagcaagaaggaggatctggtg
tttatcttctgggcccccgagtctgcgccccttaagagcaaaatgatttatgccagctcc
aaggacgccatcaagaagaagctgacagggatcaagcatgaattgcaagcaaactgctac
gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagtgccgtcatctcc
ctggagggcaagcctttgtga

DBGET integrated database retrieval system