KEGG   Homo sapiens (human): 1072Help
Entry
1072              CDS       T01001                                 

Gene name
CFL1, CFL, HEL-S-15
Definition
cofilin 1 (non-muscle)
Orthology
K05765  
cofilin
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Pertussis
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 166 aa AA seqDB search
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS
KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtgtggctgtctctgatggtgtcatcaaggtgttcaacgacatgaaggtg
cgtaagtcttcaacgccagaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg
agtgaggacaagaagaacatcatcctggaggagggcaaggagatcctggtgggcgatgtg
ggccagactgtcgacgacccctacgccacctttgtcaagatgctgccagataaggactgc
cgctatgccctctatgatgcaacctatgagaccaaggagagcaagaaggaggatctggtg
tttatcttctgggcccccgagtctgcgccccttaagagcaaaatgatttatgccagctcc
aaggacgccatcaagaagaagctgacagggatcaagcatgaattgcaagcaaactgctac
gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagtgccgtcatctcc
ctggagggcaagcctttgtga

DBGET integrated database retrieval system