KEGG   Homo sapiens (human): 1073Help
Entry
1073              CDS       T01001                                 

Gene name
CFL2, NEM7
Definition
cofilin 2 (muscle)
Orthology
K05765  
cofilin
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Pertussis
Disease
H00698  
Nemaline myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1073 (CFL2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    1073 (CFL2)
  Development
   04360 Axon guidance
    1073 (CFL2)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    1073 (CFL2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1073 (CFL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q12
AA seq 149 aa AA seqDB search
MKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPL
NDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQV
NGLDDIKDRSTLGEKLGGNVVVSLEGKPL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaggaaatcttctacacaagaggagatcaaaaagagaaagaaagcagttctc
ttctgtttaagcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtg
ggtgacattggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctg
aatgattgccgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaa
gacctagtatttatattctgggctcctgaaagtgcacctttaaaaagcaagatgatttat
gctagctctaaagatgccattaaaaagaaatttacaggtattaaacatgagtggcaagta
aatggcttggatgatattaaggaccgttcgacacttggagagaaattgggaggcaatgta
gtagtttcacttgaaggaaaaccattataa

DBGET integrated database retrieval system