KEGG   Homo sapiens (human): 10733Help
Entry
10733             CDS       T01001                                 

Gene name
PLK4, MCCRP2, SAK, STK18
Definition
(RefSeq) polo like kinase 4
  KO
K08863  
polo-like kinase 4 [EC:2.7.11.21]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Disease
H01880  
Autosomal recessive microcephaly and chorioretinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    10733 (PLK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     10733 (PLK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  PLK family [OT]
   10733 (PLK4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    10733 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     10733 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    10733 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O00444(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
4q28.1
AA seq 970 aa AA seqDB search
MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNE
VKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQI
ITGMLYLHSHGILHRDLTLSNLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISP
EIATRSAHGLESDVWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPSFLSIEAKD
LIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVEDSIDSGHATISTAITASSST
SISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQETSNSGRGRV
IQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERY
SPTDNNANIFNFFKEKTSSSSGSFERPDNNQALSNHLCPGKTPFPFADPTPQTETVQQWF
GNLQINAHLRKTTEYDSISPNRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQ
NTMKYMTALHSKPEIIQQECVFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLK
PIRQKTKKAVVSILDSEEVCVELVKEYASQEYVKEVLQISSDGNTITIYYPNGGRGFPLA
DRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKSPKITYFTRYAKCILMENSPG
ADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMDHANEGHRICL
ALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMH
SAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWAT
QLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILL
MFSNPTPNFH
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcatcggggagaagatcgaggattttaaagttggaaatctgcttggtaaa
ggatcatttgctggtgtctacagagctgagtccattcacactggtttggaagttgcaatc
aaaatgatagataagaaagccatgtacaaagcaggaatggtacagagagtccaaaatgag
gtgaaaatacattgccaattgaaacatccttctatcttggagctttataactattttgaa
gatagcaattatgtgtatctggtattagaaatgtgccataatggagaaatgaacaggtat
ctaaagaatagagtgaaacccttctcagaaaatgaagctcgacacttcatgcaccagatc
atcacagggatgttgtatcttcattctcatggtatactacaccgggacctcacactttct
aacctcctactgactcgtaatatgaacatcaagattgctgattttgggctggcaactcaa
ctgaaaatgccacatgaaaagcactatacattatgtggaactcctaactacatttcacca
gaaattgccactcgaagtgcacatggccttgaatctgatgtttggtccctgggctgtatg
ttttatacattacttatcgggagaccacccttcgacactgacacagtcaagaacacatta
aataaagtagtattggcagattatgaaatgccatcttttttgtcaatagaggccaaggac
cttattcaccagttacttcgtagaaatccagcagatcgtttaagtctgtcttcagtattg
gaccatccttttatgtcccgaaattcttcaacaaaaagtaaagatttaggaactgtggaa
gactcaattgatagtgggcatgccacaatttctactgcaattacagcttcttccagtacc
agtataagtggtagtttatttgacaaaagaagacttttgattggtcagccactcccaaat
aaaatgactgtatttccaaagaataaaagttcaactgatttttcttcttcaggagatgga
aacagtttttatactcagtggggaaatcaagaaaccagtaatagtggaaggggaagagta
attcaagatgcagaagaaaggccacattctcgataccttcgtagagcttattcctctgat
agatctggcacttctaatagtcagtctcaagcaaaaacatatacaatggaacgatgtcac
tcagcagaaatgctttcagtgtccaaaagatcaggaggaggtgaaaatgaagagaggtac
tcacccacagacaacaatgccaacatttttaacttctttaaagaaaagacatccagtagt
tctggatcttttgaaagacctgataacaatcaagcactctccaatcatctttgtccagga
aaaactccttttccatttgcagacccgacacctcagactgaaaccgtacaacagtggttt
gggaatctgcaaataaatgctcatttaagaaaaactactgaatatgacagcatcagccca
aaccgggacttccagggccatccagatttgcagaaggacacatcaaaaaatgcctggact
gatacaaaagtcaaaaagaactctgatgcttctgataatgcacattctgtaaaacagcaa
aataccatgaaatatatgactgcacttcacagtaaacctgagataatccaacaagaatgt
gtttttggctcagatcctctttctgaacagagcaagactaggggtatggagccaccatgg
ggttatcagaatcgtacattaagaagcattacatctccgttggttgctcacaggttaaaa
ccaatcagacagaaaaccaaaaaggctgtggtgagcatacttgattcagaggaggtgtgt
gtggagcttgtaaaggagtatgcatctcaagaatatgtgaaagaagttcttcagatatct
agtgatggaaatacgatcactatttattatccaaatggtggtagaggttttcctcttgct
gatagaccaccctcacctactgacaacatcagtaggtacagctttgacaatttaccagaa
aaatactggcgaaaatatcaatatgcttccaggtttgtacagcttgtaagatctaaatct
cccaaaatcacttattttacaagatatgctaaatgcattttgatggagaattctcctggt
gctgattttgaggtttggttttatgatggggtaaaaatacacaaaacagaagatttcatt
caggtgattgaaaagacagggaagtcttacactttaaaaagtgaaagtgaagttaatagc
ttgaaagaggagataaaaatgtatatggaccatgctaatgagggtcatcgtatttgttta
gcactggaatccataatttcagaagaggaaaggaaaactaggagtgctccctttttccca
ataatcataggaagaaaacctggtagtactagttcacctaaggccttatcacctcctcct
tctgtggattcaaattacccaacgagagagagagcatctttcaacagaatggtcatgcat
agtgctgcttctccaacacaggcaccaatccttaatccctctatggttacaaatgaagga
cttggtcttacaactacagcttctggaacagacatctcttctaatagtctaaaagattgt
cttcctaaatcagcacaacttttgaaatctgtttttgtgaaaaatgttggttgggctaca
cagttaactagtggagctgtgtgggttcagtttaatgatgggtcccagttggttgtgcag
gcaggagtgtcttctatcagttatacctcaccaaatggtcaaacaactaggtatggagaa
aatgaaaaattaccagactacatcaaacagaaattacagtgtctgtcttccatccttttg
atgttttctaatccgactcctaattttcattga

DBGET integrated database retrieval system