KEGG   Homo sapiens (human): 10772Help
Entry
10772             CDS       T01001                                 

Gene name
SRSF10, FUSIP1, FUSIP2, NSSR, SFRS13, SFRS13A, SRp38, SRrp40, TASR, TASR1, TASR2
Definition
serine/arginine-rich splicing factor 10
Orthology
K12900  
FUS-interacting serine-arginine-rich protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.11
AA seq 261 aa AA seqDB search
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR
SRSYERRRSRSRSFDYNYRRSYSPRNRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRS
RSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRS
QSRSRSKSRSRSWTSPKSSGH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctacctgcgtccccccaacacgtctctgttcgtcaggaacgtggccgacgac
accaggtctgaagacttgcggcgtgaatttggtcgttatggtcctatagttgatgtgtat
gttccacttgatttctacactcgccgtccaagaggatttgcttatgttcaatttgaggat
gttcgtgatgctgaagacgctttacataatttggacagaaagtggatttgtggacggcag
attgaaatacagtttgcccagggggatcgaaagacaccaaatcagatgaaagccaaggaa
gggaggaatgtgtacagttcttcacgctatgatgattatgacagatacagacgttctaga
agccgaagttatgaaaggaggagatcaagaagtcggtcttttgattacaactatagaaga
tcgtatagtcctagaaatagaccgactggaagaccacggcgtagcagaagccattccgac
aatgatagattcaaacaccgaaatcgatctttttcaagatctaaatccaattcaagatca
cggtccaagtcccagcccaagaaagaaatgaaggctaaatcacgttctaggtctgcatct
cacaccaaaactagaggcacctctaaaacagattccaaaacacattataagtctggctca
agatatgaaaaggaatcaaggaaaaaagaaccacctagatccaaatctcagtcaagatca
cagtctaggtctaggtcaaaatctagatcaaggtcttggactagtcctaagtccagtggc
cactga

DBGET integrated database retrieval system