KEGG   Homo sapiens (human): 10787Help
Entry
10787             CDS       T01001                                 

Gene name
NCKAP1, HEM2, NAP1, NAP125, p125Nap1
Definition
NCK-associated protein 1
Orthology
K05750  
NCK-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10787 (NCKAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q32
AA seq 1128 aa AA seqDB search
MSRSVLQPSQQKLAEKLTILNDRGVGMLTRLYNIKKACGDPKAKPSYLIDKNLESAVKFI
VRKFPAVETRNNNQQLAQLQKEKSEILKNLALYYFTFVDVMEFKDHVCELLNTIDVCQVF
FDITVNFDLTKNYLDLIITYTTLMILLSRIEERKAIIGLYNYAHEMTHGASDREYPRLGQ
MIVDYENPLKKMMEEFVPHSKSLSDALISLQMVYPRRNLSADQWRNAQLLSLISAPSTML
NPAQSDTMPCEYLSLDAMEKWIIFGFILCHGILNTDATALNLWKLALQSSSCLSLFRDEV
FHIHKAAEDLFVNIRGYNKRINDIRECKEAAVSHAGSMHRERRKFLRSALKELATVLSDQ
PGLLGPKALFVFMALSFARDEIIWLLRHADNMPKKSADDFIDKHIAELIFYMEELRAHVR
KYGPVMQRYYVQYLSGFDAVVLNELVQNLSVCPEDESIIMSSFVNTMTSLSVKQVEDGEV
FDFRGMRLDWFRLQAYTSVSKASLGLADHRELGKMMNTIIFHTKMVDSLVEMLVETSDLS
IFCFYSRAFEKMFQQCLELPSQSRYSIAFPLLCTHFMSCTHELCPEERHHIGDRSLSLCN
MFLDEMAKQARNLITDICTEQCTLSDQLLPKHCAKTISQAVNKKSKKQTGKKGEPEREKP
GVESMRKNRLVVTNLDKLHTALSELCFSINYVPNMVVWEHTFTPREYLTSHLEIRFTKSI
VGMTMYNQATQEIAKPSELLTSVRAYMTVLQSIENYVQIDITRVFNNVLLQQTQHLDSHG
EPTITSLYTNWYLETLLRQVSNGHIAYFPAMKAFVNLPTENELTFNAEEYSDISEMRSLS
ELLGPYGMKFLSESLMWHISSQVAELKKLVVENVDVLTQMRTSFDKPDQMAALFKRLSSV
DSVLKRMTIIGVILSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYE
LSSAAGLPCEIDPALVVALSSQKSENISPEEEYKIACLLMVFVAVSLPTLASNVMSQYSP
AIEGHCNNIHCLAKAINQIAAALFTIHKGSIEDRLKEFLALASSSLLKIGQETDKTTTRN
RESVYLLLDMIVQESPFLTMDLLESCFPYVLLRNAYHAVYKQSVTSSA
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgctcagtgctgcagcccagtcagcagaagctggcggagaagctcaccatcctc
aacgaccggggcgtcggcatgctcacccgcctctacaacatcaagaaggcatgtggagac
cccaaggcaaaaccatcctatcttatcgacaaaaacctggaatctgctgtgaaattcata
gtcagaaaattccctgctgtagaaacccgcaacaacaatcaacagcttgcacaactacag
aaagaaaaatcagagattctgaaaaatctggcattatattacttcacatttgtagatgtt
atggaatttaaggaccatgtttgtgaattgctgaatactattgacgtttgccaagtcttc
tttgatattactgtaaactttgatttaacaaagaactacttagatttaattataacctat
acaacactaatgatactgctgtctcgaattgaagaaaggaaggcaatcattggattatac
aactatgcccatgaaatgactcatggagcaagtgacagagaatacccacgccttggccag
atgattgtggattatgaaaaccctttaaagaagatgatggaagaatttgtaccccatagc
aagtctctttcagatgcactaatttctcttcaaatggtatatcctcgaaggaatctttca
gctgaccagtggagaaatgcccagttattgagcctcatcagtgcacctagtacaatgctt
aatccagcacagtccgacactatgccttgtgaatacctctctttggatgcaatggaaaag
tggattatctttggctttattttgtgccatgggatcctaaatactgacgctacagcactg
aacctttggaaactagctcttcaaagtagctcttgcctctctctctttcgggatgaagtt
ttccacattcacaaagctgcagaagacttatttgtaaacatacgaggctataataaacgt
attaatgacataagagaatgcaaggaggcagccgtgtcacatgctggttcaatgcacaga
gaaagacgcaagtttttaagatctgcactgaaggaattggctactgtcctctctgatcaa
cctggattgctaggtcccaaggcactttttgtttttatggcattatcctttgcccgtgat
gaaatcatctggctacttcgtcatgcagataacatgccaaagaagagtgcagacgacttt
atagataagcacattgctgaattaatattttacatggaagaacttagagcacatgtgagg
aaatacggacctgtaatgcagaggtattacgtgcagtacctttctggctttgatgctgtt
gtcctcaatgaactcgtgcagaatctttctgtttgccctgaagatgaatcaatcatcatg
tcctcttttgttaacactatgacttccctaagtgtaaaacaagttgaagatggggaagta
tttgatttcagaggaatgagattagattggtttaggttacaggcatatactagtgtctca
aaggcttcacttggccttgcagatcacagagaacttggaaagatgatgaatacaataatt
tttcatacaaaaatggtagattccttggtggaaatgttggtggaaacatcagatctctcc
atattttgtttttatagtcgtgcttttgagaagatgtttcaacagtgtttggagttaccc
tctcaatcaagatactcaattgcatttccactactttgcactcattttatgagttgcacg
catgaactatgtccagaagagcgacatcatattggagatcgcagtctttccttatgtaat
atgttcctagatgaaatggccaaacaagctcgaaatctcatcactgatatttgcacagaa
cagtgtacccttagtgaccagttgctacccaagcattgtgccaaaactatcagtcaagca
gtgaataagaaatcaaaaaagcagactggtaagaaaggggaacctgaaagggagaaacca
ggtgttgagagcatgaggaaaaacaggctggttgtgaccaaccttgataaattgcacact
gcactttctgagttatgcttctctataaattatgtaccaaacatggtggtatgggaacat
acctttaccccacgagaatatttgacttctcatctggaaatacgctttaccaagtcaatt
gttgggatgactatgtataatcaagccacacaggaaattgcaaaaccttcagaacttcta
acaagtgtaagagcatacatgaccgtactccagtcaatagaaaactatgtgcagattgat
attacaagagtatttaataatgtgcttcttcaacaaacacaacatttagacagtcatgga
gagccaaccattacaagtctatacacaaattggtatttggaaactttgttacgacaagtc
agcaatggccatatagcatattttcctgcaatgaaagcgtttgtgaacttacctacagaa
aatgaattaacattcaatgcagaggaatattctgacatatcagaaatgaggtcattatca
gaactactaggcccatatggtatgaagtttctaagtgaaagccttatgtggcatatttca
tcacaagttgctgaacttaagaaacttgtggtggagaatgttgatgtgttaacacaaatg
aggaccagctttgacaaaccagaccagatggctgcactgtttaaaagattatcatctgtt
gacagtgtcttgaagaggatgacaataattggtgtaattttatccttccgatcattggca
caagaagcacttagagatgtcttatcctaccacattccttttcttgtaagttcaattgaa
gattttaaggatcacattccaagggaaactgatatgaaggttgcaatgaatgtgtatgag
ttatcatcagctgccggattaccttgtgagattgatcctgcattggtcgtagctctttct
tcacaaaaatcggaaaacattagtccagaagaagagtataaaattgcctgccttctcatg
gtgtttgtggcagtttctttgccaacactggccagtaatgtgatgtctcagtacagccct
gctatagaagggcattgcaacaacatacattgcttggccaaagccatcaaccagattgct
gcagctttgtttacaattcacaaaggaagcattgaagaccgtcttaaagaatttctggcg
cttgcatcctccagtctactgaaaattggccaggagacagataaaactacaacaagaaat
agagaatctgtttatttactgctagatatgattgtacaagaatctccattccttacaatg
gatcttttggaatcttgttttccttatgtcttgctgagaaatgcataccatgctgtctac
aaacaaagtgttacatcttctgcataa

DBGET integrated database retrieval system