KEGG   Homo sapiens (human): 108Help
Entry
108               CDS       T01001                                 

Gene name
ADCY2, AC2, HBAC2
Definition
adenylate cyclase 2 (brain) (EC:4.6.1.1)
Orthology
K08042  
adenylate cyclase 2 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    108 (ADCY2)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    108 (ADCY2)
   04020 Calcium signaling pathway
    108 (ADCY2)
   04024 cAMP signaling pathway
    108 (ADCY2)
   04022 cGMP - PKG signaling pathway
    108 (ADCY2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    108 (ADCY2)
  Cellular commiunity
   04540 Gap junction
    108 (ADCY2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    108 (ADCY2)
   04062 Chemokine signaling pathway
    108 (ADCY2)
  Endocrine system
   04911 Insulin secretion
    108 (ADCY2)
   04912 GnRH signaling pathway
    108 (ADCY2)
   04913 Ovarian Steroidogenesis
    108 (ADCY2)
   04915 Estrogen signaling pathway
    108 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    108 (ADCY2)
   04921 Oxytocin signaling pathway
    108 (ADCY2)
   04918 Thyroid hormone synthesis
    108 (ADCY2)
   04916 Melanogenesis
    108 (ADCY2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108 (ADCY2)
   04270 Vascular smooth muscle contraction
    108 (ADCY2)
  Digestive system
   04970 Salivary secretion
    108 (ADCY2)
   04971 Gastric acid secretion
    108 (ADCY2)
   04972 Pancreatic secretion
    108 (ADCY2)
   04976 Bile secretion
    108 (ADCY2)
  Nervous system
   04724 Glutamatergic synapse
    108 (ADCY2)
   04727 GABAergic synapse
    108 (ADCY2)
   04725 Cholinergic synapse
    108 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    108 (ADCY2)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108 (ADCY2)
  Environmental adaptation
   04713 Circadian entrainment
    108 (ADCY2)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    108 (ADCY2)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    108 (ADCY2)
  Infectious diseases
   05166 HTLV-I infection
    108 (ADCY2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108 (ADCY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p15.3
AA seq 1091 aa AA seqDB search
MWQEAMRRRRYLRDRSEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HAHVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHS
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgctccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggctcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcgtttctaata
acagttccaactgccctggcgattttctttgcgatatttatcctggtctgcatcgagtct
gtgtttaagaagctgctgcgcctcttctcgttggtgatatggatatgccttgttgccatg
ggatacctgttcatgtgttttggaggcaccgtctctccctgggaccaggtatcgttcttc
ctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagacgccatcatt
gccagcgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaaca
ccgggaggcaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgt
gggaacctggcgggagcctaccataagcacctcatggaactcgctcttcagcaaacatat
caggacacctgtaattgcatcaagtcgcggatcaagttggaatttgaaaaacgtcaacag
gagcggcttctgctctccctgctgccggcccacatcgccatggagatgaaagcggagatc
atccagaggctgcagggccccaaggcgggccagatggagaacacaaataacttccacaac
ctgtatgtgaagcggcatacaaacgtgagcatcttatacgctgacatcgttggctttacc
cggctggcaagtgactgctccccgggagaactagtccacatgctgaatgagctctttgga
aagtttgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaa
atggggctggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aacatgcgcgtgggcgtgcattctgggaatgtcctgtgtggcgtgattggtctgcagaag
tggcaatatgatgtgtggtcacatgatgtgaccttggccaaccacatggaagctggaggg
gtccctggacgtgttcacatttcttctgtcaccctggagcacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacc
tactttgtgatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgc
cacacccttgatggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcc
tggggggcagccaagccctttgcacacctacatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaagagatttgaagaagaattgaatgaaaggatgattcaagca
attgatgggattaatgcacagaagcaatggctcaagtctgaagacattcagagaatctca
ctgcttttctataacaaagtactagaaaaagagtaccgggccacggcactgccagcgttc
aagtattatgtgacttgtgcctgtctcatattcttctgcatcttcattgtgcagattctc
gtgctgccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggcc
ttcatcctcttcgtctgctttgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcatgtggcttttgaagtcctcgggcatcattgccaaccgcccctggccacggatc
tctctcacgatcatcaccacagccatcatattaatgatggccgtgttcaacatgtttttc
ctgagtgactcagaggaaacaatccctccaactgccaacacaacaaacacaagcttttca
gcctcaaataatcaggtggcgattctgcgtgcgcagaatttatttttcctcccgtacttt
atctacagctgcattctgggactgatatcctgttccgtgttcctgcgggtaaactatgag
ctgaagatgttgatcatgatggtggccttggtgggctacaacaccatcctactccacacc
cacgcccacgtcctgggcgactacagccaggtcttatttgagagaccaggcatttggaaa
gacctgaagaccatgggctctgtgtctctctctatattcttcatcacactgcttgttctg
ggtagacagaatgaatattactgtaggttagacttcttatggaagaacaaattcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgcgtgctgctggagaacgtgctt
cccgcgcacgtggctgagcacttcctggccaggagcctgaagaatgaggagctataccac
cagtcctatgactgcgtctgcgtcatgtttgcctccattccggatttcaaagaattttat
acagaatccgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatc
gctgactttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagacc
attggcagcacatacatggcagcaacaggtctgagcgctgtgcccagccaggagcactcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcttttgccctg
gtagggaagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtgggt
attaaccatggacctgtgatagctggtgtgattggagctcagaagccacaatatgatatc
tggggcaacactgtcaatgtggccagtaggatggacagcaccggagtcctggacaaaata
caggttaccgaggagacgagcctcgtcctgcagaccctcggatacacgtgcacctgtcga
ggaataatcaacgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaacgtggcatcctga

DBGET integrated database retrieval system