KEGG   Homo sapiens (human): 10800Help
Entry
10800             CDS       T01001                                 

Gene name
CYSLTR1, CYSLT1, CYSLT1R, CYSLTR, HMTMF81
Definition
cysteinyl leukotriene receptor 1
Orthology
K04322  
cysteinyl leukotriene receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Zafirlukast: 
Pranlukast: 
Montelukast: 
Ibudilast: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    10800 (CYSLTR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10800 (CYSLTR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    10800 (CYSLTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
Xq13.2-q21.1
AA seq 337 aa AA seqDB search
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacaggaaatctgacagtatcttctgccacatgccatgacactattgatgac
ttccgcaatcaagtgtattccaccttgtactctatgatctctgttgtaggcttctttggc
aatggctttgtgctctatgtcctcataaaaacctatcacaagaagtcagccttccaagta
tacatgattaatttagcagtagcagatctactttgtgtgtgcacactgcctctccgtgtg
gtctattatgttcacaaaggcatttggctctttggtgacttcttgtgccgcctcagcacc
tatgctttgtatgtcaacctctattgtagcatcttctttatgacagccatgagctttttc
cggtgcattgcaattgtttttccagtccagaacattaatttggttacacagaaaaaagcc
aggtttgtgtgtgtaggtatttggatttttgtgattttgaccagttctccatttctaatg
gccaaaccacaaaaagatgagaaaaataataccaagtgctttgagcccccacaagacaat
caaactaaaaatcatgttttggtcttgcattatgtgtcattgtttgttggctttatcatc
ccttttgttattataattgtctgttacacaatgatcattttgaccttactaaaaaaatca
atgaaaaaaaatctgtcaagtcataaaaaggctataggaatgatcatggtcgtgaccgct
gcctttttagtcagtttcatgccatatcatattcaacgtaccattcaccttcatttttta
cacaatgaaactaaaccctgtgattctgtccttagaatgcagaagtccgtggtcataacc
ttgtctctggctgcatccaattgttgctttgaccctctcctatatttcttttctgggggt
aactttaggaaaaggctgtctacattcagaaagcattctttgtccagcgtgacttatgta
cccagaaagaaggcctctttgccagaaaaaggagaagaaatatgtaaagtatag

DBGET integrated database retrieval system