KEGG   Homo sapiens (human): 10800Help
Entry
10800             CDS       T01001                                 

Gene name
CYSLTR1, CYSLT1, CYSLT1R, CYSLTR, HMTMF81
Definition
cysteinyl leukotriene receptor 1
Orthology
K04322  
cysteinyl leukotriene receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Drug target
Zafirlukast: 
Pranlukast: 
Montelukast: 
Ibudilast: 
Other: 
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
Xq13.2-q21.1
AA seq 337 aa AA seqDB search
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacaggaaatctgacagtatcttctgccacatgccatgacactattgatgac
ttccgcaatcaagtgtattccaccttgtactctatgatctctgttgtaggcttctttggc
aatggctttgtgctctatgtcctcataaaaacctatcacaagaagtcagccttccaagta
tacatgattaatttagcagtagcagatctactttgtgtgtgcacactgcctctccgtgtg
gtctattatgttcacaaaggcatttggctctttggtgacttcttgtgccgcctcagcacc
tatgctttgtatgtcaacctctattgtagcatcttctttatgacagccatgagctttttc
cggtgcattgcaattgtttttccagtccagaacattaatttggttacacagaaaaaagcc
aggtttgtgtgtgtaggtatttggatttttgtgattttgaccagttctccatttctaatg
gccaaaccacaaaaagatgagaaaaataataccaagtgctttgagcccccacaagacaat
caaactaaaaatcatgttttggtcttgcattatgtgtcattgtttgttggctttatcatc
ccttttgttattataattgtctgttacacaatgatcattttgaccttactaaaaaaatca
atgaaaaaaaatctgtcaagtcataaaaaggctataggaatgatcatggtcgtgaccgct
gcctttttagtcagtttcatgccatatcatattcaacgtaccattcaccttcatttttta
cacaatgaaactaaaccctgtgattctgtccttagaatgcagaagtccgtggtcataacc
ttgtctctggctgcatccaattgttgctttgaccctctcctatatttcttttctgggggt
aactttaggaaaaggctgtctacattcagaaagcattctttgtccagcgtgacttatgta
cccagaaagaaggcctctttgccagaaaaaggagaagaaatatgtaaagtatag

DBGET integrated database retrieval system