KEGG   Homo sapiens (human): 10800Help
Entry
10800             CDS       T01001                                 

Gene name
CYSLTR1, CYSLT1, CYSLT1R, CYSLTR, HMTMF81
Definition
(RefSeq) cysteinyl leukotriene receptor 1
  KO
K04322  cysteinyl leukotriene receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Ablukast (DG01244): D02739 D02741
Cinalukast: D02846
Ibudilast: D01385
Montelukast (DG01066): D00529 D08229
Pobilukast edamine: D02848
Pranlukast (DG01065): D02732 D08408
Ritolukast: D02849
Sulukast: D02850
Tipelukast: D06659
Tomelukast: D02851
Verlukast: D02384
Zafirlukast: D00411
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    10800 (CYSLTR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    10800 (CYSLTR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    10800 (CYSLTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx 7TM_GPCR_Srv DUF420 DUF4064 SieB Shisa COX7C TMEM234
Motif
Other DBs
NCBI-GeneID: 10800
NCBI-ProteinID: NP_001269115
OMIM: 300201
HGNC: 17451
Ensembl: ENSG00000173198
Vega: OTTHUMG00000021889
Pharos: Q9Y271(Tclin)
UniProt: Q9Y271 Q38Q91 Q38Q88
Position
Xq21.1
AA seq 337 aa AA seqDB search
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQV
YMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFF
RCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDN
QTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTA
AFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGG
NFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaacaggaaatctgacagtatcttctgccacatgccatgacactattgatgac
ttccgcaatcaagtgtattccaccttgtactctatgatctctgttgtaggcttctttggc
aatggctttgtgctctatgtcctcataaaaacctatcacaagaagtcagccttccaagta
tacatgattaatttagcagtagcagatctactttgtgtgtgcacactgcctctccgtgtg
gtctattatgttcacaaaggcatttggctctttggtgacttcttgtgccgcctcagcacc
tatgctttgtatgtcaacctctattgtagcatcttctttatgacagccatgagctttttc
cggtgcattgcaattgtttttccagtccagaacattaatttggttacacagaaaaaagcc
aggtttgtgtgtgtaggtatttggatttttgtgattttgaccagttctccatttctaatg
gccaaaccacaaaaagatgagaaaaataataccaagtgctttgagcccccacaagacaat
caaactaaaaatcatgttttggtcttgcattatgtgtcattgtttgttggctttatcatc
ccttttgttattataattgtctgttacacaatgatcattttgaccttactaaaaaaatca
atgaaaaaaaatctgtcaagtcataaaaaggctataggaatgatcatggtcgtgaccgct
gcctttttagtcagtttcatgccatatcatattcaacgtaccattcaccttcatttttta
cacaatgaaactaaaccctgtgattctgtccttagaatgcagaagtccgtggtcataacc
ttgtctctggctgcatccaattgttgctttgaccctctcctatatttcttttctgggggt
aactttaggaaaaggctgtctacattcagaaagcattctttgtccagcgtgacttatgta
cccagaaagaaggcctctttgccagaaaaaggagaagaaatatgtaaagtatag

DBGET integrated database retrieval system