KEGG   Homo sapiens (human): 10803Help
Entry
10803             CDS       T01001                                 

Gene name
CCR9, CC-CKR-9, CDw199, GPR-9-6, GPR28
Definition
chemokine (C-C motif) receptor 9
Orthology
K04184  
C-C chemokine receptor type 9
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Intestinal immune network for IgA production
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    10803 (CCR9)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    10803 (CCR9)
   04062 Chemokine signaling pathway
    10803 (CCR9)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CC Chemokine
    10803 (CCR9)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   10803 (CCR9)
Cellular antigens [BR:hsa04090]
 Proteins
  10803 (CCR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p21.3
AA seq 357 aa AA seqDB search
MADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILV
YWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYS
CVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEE
SGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKA
LKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCL
NPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgactatggctctgaatccacatcttccatggaagactacgttaacttcaac
ttcactgacttctactgtgagaaaaacaatgtcaggcagtttgcgagccatttcctccca
cccttgtactggctcgtgttcatcgtgggtgccttgggcaacagtcttgttatccttgtc
tactggtactgcacaagagtgaagaccatgaccgacatgttccttttgaatttggcaatt
gctgacctcctctttcttgtcactcttcccttctgggccattgctgctgctgaccagtgg
aagttccagaccttcatgtgcaaggtggtcaacagcatgtacaagatgaacttctacagc
tgtgtgttgctgatcatgtgcatcagcgtggacaggtacattgccattgcccaggccatg
agagcacatacttggagggagaaaaggcttttgtacagcaaaatggtttgctttaccatc
tgggtattggcagctgctctctgcatcccagaaatcttatacagccaaatcaaggaggaa
tccggcattgctatctgcaccatggtttaccctagcgatgagagcaccaaactgaagtca
gctgtcttgaccctgaaggtcattctggggttcttccttcccttcgtggtcatggcttgc
tgctataccatcatcattcacaccctgatacaagccaagaagtcttccaagcacaaagcc
ctaaaagtgaccatcactgtcctgaccgtctttgtcttgtctcagtttccctacaactgc
attttgttggtgcagaccattgacgcctatgccatgttcatctccaactgtgccgtttcc
accaacattgacatctgcttccaggtcacccagaccatcgccttcttccacagttgcctg
aaccctgttctctatgtttttgtgggtgagagattccgccgggatctcgtgaaaaccctg
aagaacttgggttgcatcagccaggcccagtgggtttcatttacaaggagagagggaagc
ttgaagctgtcgtctatgttgctggagacaacctcaggagcactctccctctga

DBGET integrated database retrieval system