KEGG   Homo sapiens (human): 10840Help
Entry
10840             CDS       T01001                                 

Gene name
ALDH1L1, 10-FTHFDH, 10-fTHF, FDH, FTHFD
Definition
aldehyde dehydrogenase 1 family, member L1 (EC:1.5.1.6)
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    10840 (ALDH1L1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     10840 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 912 aa AA seqDB search
MAGPSNPPATMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDG
VPVFKYSRWRAKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLL
PRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFP
EGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKV
PGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVK
NIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKS
GAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVE
MAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKD
AFENGRWGKISARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTF
RYFAGWCDKIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAA
GNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTG
STEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAA
GRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGA
TLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANAT
EFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALN
EYLRVKTVTFEY
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtccttccaaccctcctgctaccatgaagattgcagtgattggacagagcctg
tttggccaggaagtttactgccacctgaggaaggagggccacgaagtggtgggtgtgttc
actgttccagacaaggatggaaaggccgaccccctgggtctggaagctgagaaggatgga
gtgccggtattcaagtactcccggtggcgtgcaaaaggacaggctttgcctgatgtggtg
gcaaaataccaggctttgggggccgagctcaacgtcctgcccttctgcagccaattcatc
cccatggagataatcagtgccccccggcatggctccatcatctatcacccgtcactgctc
cctaggcaccgaggggcctcggccatcaactggaccctcattcacggagataagaaaggg
gggttttccatcttctgggcggatgatggtctggacaccggagacctgctgctgcagaag
gagtgtgaggtgctcccggacgacaccgtgagcacgctgtacaaccgcttcctcttccct
gaaggcatcaaagggatggtgcaggccgtgaggctgatcgctgagggcaaagcccccaga
ctccctcagcctgaggaaggagccacctatgaggggattcagaagaaggagacagccaag
atcaactgggaccagccggcagaggccattcacaactggatccgcgggaacgacaaggtg
ccgggagcctggacagaggcctgtgaacagaaactgacatttttcaactcaacgctgaac
acttcaggcctggtgcccgagggagacgctttgcccatcccaggagcccatcggccaggg
gtggtcaccaaagcaggactcatcctctttgggaatgatgacaaaatgctgctggtgaag
aatattcagctggaggatggcaaaatgatcctggcctcgaacttctttaagggggcagcc
agcagtgtccttgagctgacagaggcagagctggttactgcggaggctgtgcggagtgtt
tggcagcggatcctccccaaagtcctggaggttgaagactccactgatttcttcaagtca
ggggccgcgtctgtggacgttgtgaggctggtggaggaagtgaaggagctgtgtgatggc
ctggagttagaaaatgaagatgtgtacatggcatccacctttggggacttcatccagctg
ttagtgaggaagctgcgaggggacgatgaggagggcgagtgcagcattgactacgtggaa
atggcagtgaacaagcgcactgtccgcatgccccaccagctcttcattgggggggagttc
gtggatgccgagggcgccaagacctctgagaccatcaatcccaccgatggaagtgtcatc
tgccaggtatccctggcccaagtcaccgacgtcgacaaggcagtggccgcagccaaggat
gcctttgagaatggacggtgggggaagatcagtgcgcgggaccggggccggctgatgtac
aggttggcagatctcatggagcagcaccaggaggagctggccaccattgaggccctggat
gcgggtgccgtctacacgctggccctgaagacccacgtgggcatgtccatccagaccttc
cgctactttgctggctggtgtgacaagatccagggctccaccatccccatcaaccaggcc
agacccaaccgcaacctgaccttgaccaggaaggagcctgttggggtttgtggcatcatc
atcccctggaactatcccctgatgatgctgtcctggaagacagctgcctgcctggctgcc
gggaacacagtggtgatcaagcctgctcaggtgaccccactcacagccttgaagtttgca
gagctgacattaaaggccggcattcccaaaggtgtggttaacgtcctcccaggatctggc
tccctggtcggccagagactctcagaccatcctgatgtgaggaaaatcgggttcacaggc
tccacagaggtgggcaagcacatcatgaaaagctgtgccataagtaacgtgaagaaggtg
tccctggaactgggcgggaagtcacccctcatcatctttgctgactgtgacctcaacaag
gctgtgcagatggggatgagttctgttttcttcaacaaaggagagaattgcattgcagca
ggccgactctttgtggaggactccattcatgatgagttcgtgcggagagtggtagaagag
gtgcggaagatgaaggtgggcaacccgctggacagggacaccgaccacgggccgcagaat
caccatgcccaccttgtgaagctgatggagtactgccagcatggcgtgaaggaaggggcc
acactggtctgcggcgggaatcaggtccctcggccagggttcttctttgagccaactgtt
ttcacagacgtggaagaccacatgttcatagccaaggaggagtccttcgggcctgtcatg
atcatctctcggtttgctgatggggacttggatgccgtgctgtctcgggccaatgccacg
gaatttggcctggcttctggtgtcttcaccagggacatcaacaaggccctgtatgtcagt
gacaagctccaggcaggcactgtgtttgtcaacacgtacaacaagaccgacgtggccgct
cccttcggaggattcaaacagtctggatttggcaaagatctaggagaggcggctctgaac
gagtacctgcgggtcaagacagtgaccttcgaatactga

DBGET integrated database retrieval system