KEGG   Homo sapiens (human): 10840Help
Entry
10840             CDS       T01001                                 

Gene name
ALDH1L1, 10-FTHFDH, 10-fTHF, FDH, FTHFD
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L1
  KO
K00289  formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    10840 (ALDH1L1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     10840 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh Formyl_trans_N Formyl_trans_C PP-binding DUF1487
Motif
Other DBs
NCBI-GeneID: 10840
NCBI-ProteinID: NP_036322
OMIM: 600249
HGNC: 3978
Ensembl: ENSG00000144908
Vega: OTTHUMG00000125551
Pharos: O75891(Tbio)
UniProt: O75891 Q53H87
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWR
AKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKVPGAWTEACEQ
KLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGKMI
LASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKI
SARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGATLVCGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagtgattggacagagcctgtttggccaggaagtttactgccacctgagg
aaggagggccacgaagtggtgggtgtgttcactgttccagacaaggatggaaaggccgac
cccctgggtctggaagctgagaaggatggagtgccggtattcaagtactcccggtggcgt
gcaaaaggacaggctttgcctgatgtggtggcaaaataccaggctttgggggccgagctc
aacgtcctgcccttctgcagccaattcatccccatggagataatcagtgccccccggcat
ggctccatcatctatcacccgtcactgctccctaggcaccgaggggcctcggccatcaac
tggaccctcattcacggagataagaaaggggggttttccatcttctgggcggatgatggt
ctggacaccggagacctgctgctgcagaaggagtgtgaggtgctcccggacgacaccgtg
agcacgctgtacaaccgcttcctcttccctgaaggcatcaaagggatggtgcaggccgtg
aggctgatcgctgagggcaaagcccccagactccctcagcctgaggaaggagccacctat
gaggggattcagaagaaggagacagccaagatcaactgggaccagccggcagaggccatt
cacaactggatccgcgggaacgacaaggtgccgggagcctggacagaggcctgtgaacag
aaactgacatttttcaactcaacgctgaacacttcaggcctggtgcccgagggagacgct
ttgcccatcccaggagcccatcggccaggggtggtcaccaaagcaggactcatcctcttt
gggaatgatgacaaaatgctgctggtgaagaatattcagctggaggatggcaaaatgatc
ctggcctcgaacttctttaagggggcagccagcagtgtccttgagctgacagaggcagag
ctggttactgcggaggctgtgcggagtgtttggcagcggatcctccccaaagtcctggag
gttgaagactccactgatttcttcaagtcaggggccgcgtctgtggacgttgtgaggctg
gtggaggaagtgaaggagctgtgtgatggcctggagttagaaaatgaagatgtgtacatg
gcatccacctttggggacttcatccagctgttagtgaggaagctgcgaggggacgatgag
gagggcgagtgcagcattgactacgtggaaatggcagtgaacaagcgcactgtccgcatg
ccccaccagctcttcattgggggggagttcgtggatgccgagggcgccaagacctctgag
accatcaatcccaccgatggaagtgtcatctgccaggtatccctggcccaagtcaccgac
gtcgacaaggcagtggccgcagccaaggatgcctttgagaatggacggtgggggaagatc
agtgcgcgggaccggggccggctgatgtacaggttggcagatctcatggagcagcaccag
gaggagctggccaccattgaggccctggatgcgggtgccgtctacacgctggccctgaag
acccacgtgggcatgtccatccagaccttccgctactttgctggctggtgtgacaagatc
cagggctccaccatccccatcaaccaggccagacccaaccgcaacctgaccttgaccagg
aaggagcctgttggggtttgtggcatcatcatcccctggaactatcccctgatgatgctg
tcctggaagacagctgcctgcctggctgccgggaacacagtggtgatcaagcctgctcag
gtgaccccactcacagccttgaagtttgcagagctgacattaaaggccggcattcccaaa
ggtgtggttaacgtcctcccaggatctggctccctggtcggccagagactctcagaccat
cctgatgtgaggaaaatcgggttcacaggctccacagaggtgggcaagcacatcatgaaa
agctgtgccataagtaacgtgaagaaggtgtccctggaactgggcgggaagtcacccctc
atcatctttgctgactgtgacctcaacaaggctgtgcagatggggatgagttctgttttc
ttcaacaaaggagagaattgcattgcagcaggccgactctttgtggaggactccattcat
gatgagttcgtgcggagagtggtagaagaggtgcggaagatgaaggtgggcaacccgctg
gacagggacaccgaccacgggccgcagaatcaccatgcccaccttgtgaagctgatggag
tactgccagcatggcgtgaaggaaggggccacactggtctgcggcgggaatcaggtccct
cggccagggttcttctttgagccaactgttttcacagacgtggaagaccacatgttcata
gccaaggaggagtccttcgggcctgtcatgatcatctctcggtttgctgatggggacttg
gatgccgtgctgtctcgggccaatgccacggaatttggcctggcttctggtgtcttcacc
agggacatcaacaaggccctgtatgtcagtgacaagctccaggcaggcactgtgtttgtc
aacacgtacaacaagaccgacgtggccgctcccttcggaggattcaaacagtctggattt
ggcaaagatctaggagaggcggctctgaacgagtacctgcgggtcaagacagtgaccttc
gaatactga

DBGET integrated database retrieval system