KEGG   Homo sapiens (human): 10846Help
Entry
10846             CDS       T01001                                 

Gene name
PDE10A, ADSD2, HSPDE10A, IOLOD, LINC00473, PDE10A19
Definition
(RefSeq) phosphodiesterase 10A
  KO
K18438  
cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Morphine addiction
Disease
H01570  
Autosomal dominant striatal degeneration (ADSD)
Drug target
Aminophylline (DG01062): 
Bucladesine (DG00230): 
Caffeine (DG00974): 
Choline theophyllinate: 
Flavoxate (DG00477): 
Moxaverine (DG00045): 
Papaverine (DG00043): 
Propentofylline: 
Proxyphylline: 
Theophylline (DG01061): 
Tibenelast sodium: 
Trapidil: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    10846 (PDE10A)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    10846 (PDE10A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     10846 (PDE10A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     10846 (PDE10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q26
AA seq 779 aa AA seqDB search
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaggatagaagagaggaaatcccaacatttaacaggtttgacagatgaaaaagtgaag
gcatatctttctcttcacccccaggtattagatgaatttgtatctgaaagtgttagtgca
gagacagtagagaaatggctgaagaggaagaacaacaaatcagaagatgaatcagctcct
aaggaagtcagcaggtaccaagatacgaatatgcagggagttgtatatgaactaaacagc
tatatagaacaacggttggacacaggaggagacaaccagctactcctctatgaactgagc
agcatcattaaaatagccacaaaagccgatggatttgcactgtatttccttggagagtgc
aataatagcctgtgtatattcacgccacctgggataaaggaaggaaaaccccgcctcatc
cctgctgggcccatcactcagggcaccaccgtctctgcttatgtggccaagtccaggaaa
acactgctagtagaagacatccttggagatgaacgatttccaagaggtactggactggaa
tcagggactcgtatccagtctgttctttgcttaccaattgtcactgcaattggtgacttg
attggtattctcgagctgtatcggcactggggcaaagaagccttctgtcttagtcaccag
gaggttgcaacagcaaatcttgcctgggcttcagtagcaatacatcaggtgcaggtatgc
agaggccttgccaaacagacagaattgaatgacttcctactcgacgtatcaaaaacatat
tttgataacatagttgcaatagattctctacttgaacacataatgatatatgcaaaaaac
ctggtgaatgccgatcgttgtgcgcttttccaggtggaccataagaacaaggagttatat
tcagacctttttgatattggagaggaaaaggaaggaaaacctgtcttcaagaagaccaaa
gagataagattttcaattgagaaaggaattgctggccaagtagcaagaacaggggaagtc
ctgaacattccagatgcctatgcagacccacgctttaacagagaagtagacttgtacaca
ggctacaccacgcggaacatcctgtgcatgcccatcgtcagccgaggcagcgtgataggt
gtggtgcagatggtcaacaaaatcagtggcagtgccttctctaaaacagatgaaaacaac
ttcaaaatgtttgccgtcttttgtgctttagccttacactgtgctaatatgtatcataga
attcgccactcagagtgcatttaccgggtaacgatggaaaagctgtcctaccatagcatt
tgtacttcagaagagtggcaaggtctcatgcaattcacccttcccgtgcgtctctgcaaa
gaaattgaattattccactttgacattggtccttttgaaaacatgtggcctggaattttt
gtctacatggttcatcggtcctgtgggacatcctgctttgagcttgaaaagttgtgtcgt
tttattatgtctgtgaagaagaactatcggcgggttccttatcacaactggaagcatgcg
gtcactgtagcacactgcatgtatgccatacttcagaacaatcacacgcttttcacagac
cttgagcgcaaaggactgctgattgcgtgtctgtgtcatgacctggaccacaggggcttc
agtaacagctacctgcagaagttcgaccaccctctggccgctctctactccacttccacc
atggagcagcaccacttctcccagactgtgtccatcctccagttggaagggcacaatatc
ttctccactctgagctccagtgaatatgagcaggtgcttgagatcatccgcaaagccatc
attgccacagaccttgctttatactttggaaacaggaagcagttggaagagatgtaccag
accggatcactaaaccttaataatcaatcacatagagaccgtgtaattggtttgatgatg
actgcctgtgacctttgttctgtgacaaaactgtggcccgttacaaaattgacggcaaat
gatatatatgcagaattctgggctgagggtgatgaaatgaagaaattgggaatacagcct
attcctatgatggacagagacaagaaggatgaagtcccccaaggccagcttgggttctac
aatgccgtggccattccctgctatacaacccttacccagatcctccctcccacggagcct
cttctgaaagcatgcagggataatctcagtcagtgggagaaggtgattcgaggggaggag
actgcaacctggatttcatccccatccgtggctcagaaggcagctgcatctgaagattga

DBGET integrated database retrieval system