KEGG   Homo sapiens (human): 10855Help
Entry
10855             CDS       T01001                                 

Gene name
HPSE, HPA, HPA1, HPR1, HPSE1, HSE1
Definition
heparanase (EC:3.2.1.166)
Orthology
K07964  
heparanase 1 [EC:3.2.1.166]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Proteoglycans in cancer
Module
Heparan sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    10855 (HPSE)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    10855 (HPSE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     10855 (HPSE)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Enzymes (General comment) Variety
  10855 (HPSE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.3
AA seq 543 aa AA seqDB search
MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVT
IDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQS
QVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCS
GLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGS
QLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFA
AGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM
ASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLL
RPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVA
ACI
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcgctcgaagcctgcgctgccgccgccgctgatgctgctgctcctggggccg
ctgggtcccctctcccctggcgccctgccccgacctgcgcaagcacaggacgtcgtggac
ctggacttcttcacccaggagccgctgcacctggtgagcccctcgttcctgtccgtcacc
attgacgccaacctggccacggacccgcggttcctcatcctcctgggttctccaaagctt
cgtaccttggccagaggcttgtctcctgcgtacctgaggtttggtggcaccaagacagac
ttcctaattttcgatcccaagaaggaatcaacctttgaagagagaagttactggcaatct
caagtcaaccaggatatttgcaaatatggatccatccctcctgatgtggaggagaagtta
cggttggaatggccctaccaggagcaattgctactccgagaacactaccagaaaaagttc
aagaacagcacctactcaagaagctctgtagatgtgctatacacttttgcaaactgctca
ggactggacttgatctttggcctaaatgcgttattaagaacagcagatttgcagtggaac
agttctaatgctcagttgctcctggactactgctcttccaaggggtataacatttcttgg
gaactaggcaatgaacctaacagtttccttaagaaggctgatattttcatcaatgggtcg
cagttaggagaagattttattcaattgcataaacttctaagaaagtccaccttcaaaaat
gcaaaactctatggtcctgatgttggtcagcctcgaagaaagacggctaagatgctgaag
agcttcctgaaggctggtggagaagtgattgattcagttacatggcatcactactatttg
aatggacggactgctaccaaggaagattttctaaaccctgatgtattggacatttttatt
tcatctgtgcaaaaagttttccaggtggttgagagcaccaggcctggcaagaaggtctgg
ttaggagaaacaagctctgcatatggaggcggagcgcccttgctatccgacacctttgca
gctggctttatgtggctggataaattgggcctgtcagcccgaatgggaatagaagtggtg
atgaggcaagtattctttggagcaggaaactaccatttagtggatgaaaacttcgatcct
ttacctgattattggctatctcttctgttcaagaaattggtgggcaccaaggtgttaatg
gcaagcgtgcaaggttcaaagagaaggaagcttcgagtataccttcattgcacaaacact
gacaatccaaggtataaagaaggagatttaactctgtatgccataaacctccataatgtc
accaagtacttgcggttaccctatcctttttctaacaagcaagtggataaataccttcta
agacctttgggacctcatggattactttccaaatctgtccaactcaatggtctaactcta
aagatggtggatgatcaaaccttgccacctttaatggaaaaacctctccggccaggaagt
tcactgggcttgccagctttctcatatagtttttttgtgataagaaatgccaaagttgct
gcttgcatctga

DBGET integrated database retrieval system