KEGG   Homo sapiens (human): 10855Help
Entry
10855             CDS       T01001                                 

Gene name
HPSE, HPA, HPA1, HPR1, HPSE1, HSE1
Definition
heparanase (EC:3.2.1.166)
Orthology
K07964  
heparanase 1 [EC:3.2.1.166]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan degradation
Metabolic pathways
Proteoglycans in cancer
Module
Heparan sulfate degradation
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:hsa00531]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.3
AA seq 543 aa AA seqDB search
MLLRSKPALPPPLMLLLLGPLGPLSPGALPRPAQAQDVVDLDFFTQEPLHLVSPSFLSVT
IDANLATDPRFLILLGSPKLRTLARGLSPAYLRFGGTKTDFLIFDPKKESTFEERSYWQS
QVNQDICKYGSIPPDVEEKLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCS
GLDLIFGLNALLRTADLQWNSSNAQLLLDYCSSKGYNISWELGNEPNSFLKKADIFINGS
QLGEDFIQLHKLLRKSTFKNAKLYGPDVGQPRRKTAKMLKSFLKAGGEVIDSVTWHHYYL
NGRTATKEDFLNPDVLDIFISSVQKVFQVVESTRPGKKVWLGETSSAYGGGAPLLSDTFA
AGFMWLDKLGLSARMGIEVVMRQVFFGAGNYHLVDENFDPLPDYWLSLLFKKLVGTKVLM
ASVQGSKRRKLRVYLHCTNTDNPRYKEGDLTLYAINLHNVTKYLRLPYPFSNKQVDKYLL
RPLGPHGLLSKSVQLNGLTLKMVDDQTLPPLMEKPLRPGSSLGLPAFSYSFFVIRNAKVA
ACI
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgcgctcgaagcctgcgctgccgccgccgctgatgctgctgctcctggggccg
ctgggtcccctctcccctggcgccctgccccgacctgcgcaagcacaggacgtcgtggac
ctggacttcttcacccaggagccgctgcacctggtgagcccctcgttcctgtccgtcacc
attgacgccaacctggccacggacccgcggttcctcatcctcctgggttctccaaagctt
cgtaccttggccagaggcttgtctcctgcgtacctgaggtttggtggcaccaagacagac
ttcctaattttcgatcccaagaaggaatcaacctttgaagagagaagttactggcaatct
caagtcaaccaggatatttgcaaatatggatccatccctcctgatgtggaggagaagtta
cggttggaatggccctaccaggagcaattgctactccgagaacactaccagaaaaagttc
aagaacagcacctactcaagaagctctgtagatgtgctatacacttttgcaaactgctca
ggactggacttgatctttggcctaaatgcgttattaagaacagcagatttgcagtggaac
agttctaatgctcagttgctcctggactactgctcttccaaggggtataacatttcttgg
gaactaggcaatgaacctaacagtttccttaagaaggctgatattttcatcaatgggtcg
cagttaggagaagattttattcaattgcataaacttctaagaaagtccaccttcaaaaat
gcaaaactctatggtcctgatgttggtcagcctcgaagaaagacggctaagatgctgaag
agcttcctgaaggctggtggagaagtgattgattcagttacatggcatcactactatttg
aatggacggactgctaccaaggaagattttctaaaccctgatgtattggacatttttatt
tcatctgtgcaaaaagttttccaggtggttgagagcaccaggcctggcaagaaggtctgg
ttaggagaaacaagctctgcatatggaggcggagcgcccttgctatccgacacctttgca
gctggctttatgtggctggataaattgggcctgtcagcccgaatgggaatagaagtggtg
atgaggcaagtattctttggagcaggaaactaccatttagtggatgaaaacttcgatcct
ttacctgattattggctatctcttctgttcaagaaattggtgggcaccaaggtgttaatg
gcaagcgtgcaaggttcaaagagaaggaagcttcgagtataccttcattgcacaaacact
gacaatccaaggtataaagaaggagatttaactctgtatgccataaacctccataatgtc
accaagtacttgcggttaccctatcctttttctaacaagcaagtggataaataccttcta
agacctttgggacctcatggattactttccaaatctgtccaactcaatggtctaactcta
aagatggtggatgatcaaaccttgccacctttaatggaaaaacctctccggccaggaagt
tcactgggcttgccagctttctcatatagtttttttgtgataagaaatgccaaagttgct
gcttgcatctga

DBGET integrated database retrieval system