KEGG   Homo sapiens (human): 10891Help
Entry
10891             CDS       T01001                                 

Gene name
PPARGC1A, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Definition
peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Orthology
K07202  
alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    10891 (PPARGC1A)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    10891 (PPARGC1A)
   04920 Adipocytokine signaling pathway
    10891 (PPARGC1A)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    10891 (PPARGC1A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    10891 (PPARGC1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.1
AA seq 798 aa AA seqDB search
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgggacatgtgcaaccaggactctgagtctgtatggagtgacatcgagtgtgct
gctctggttggtgaagaccagcctctttgcccagatcttcctgaacttgatctttctgaa
ctagatgtgaacgacttggatacagacagctttctgggtggactcaagtggtgcagtgac
caatcagaaataatatccaatcagtacaacaatgagccttcaaacatatttgagaagata
gatgaagagaatgaggcaaacttgctagcagtcctcacagagacactagacagtctccct
gtggatgaagacggattgccctcatttgatgcgctgacagatggagacgtgaccactgac
aatgaggctagtccttcctccatgcctgacggcacccctccaccccaggaggcagaagag
ccgtctctacttaagaagctcttactggcaccagccaacactcagctaagttataatgaa
tgcagtggtctcagtacccagaaccatgcaaatcacaatcacaggatcagaacaaaccct
gcaattgttaagactgagaattcatggagcaataaagcgaagagtatttgtcaacagcaa
aagccacaaagacgtccctgctcggagcttctcaaatatctgaccacaaacgatgaccct
cctcacaccaaacccacagagaacagaaacagcagcagagacaaatgcacctccaaaaag
aagtcccacacacagtcgcagtcacaacacttacaagccaaaccaacaactttatctctt
cctctgaccccagagtcaccaaatgaccccaagggttccccatttgagaacaagactatt
gaacgcaccttaagtgtggaactctctggaactgcaggcctaactccacccaccactcct
cctcataaagccaaccaagataacccttttagggcttctccaaagctgaagtcctcttgc
aagactgtggtgccaccaccatcaaagaagcccaggtacagtgagtcttctggtacacaa
ggcaataactccaccaagaaagggccggagcaatccgagttgtatgcacaactcagcaag
tcctcagtcctcactggtggacacgaggaaaggaagaccaagcggcccagtctgcggctg
tttggtgaccatgactattgccagtcaattaattccaaaacagaaatactcattaatata
tcacaggagctccaagactctagacaactagaaaataaagatgtctcctctgattggcag
gggcagatttgttcttccacagattcagaccagtgctacctgagagagactttggaggca
agcaagcaggtctctccttgcagcacaagaaaacagctccaagaccaggaaatccgagcc
gagctgaacaagcacttcggtcatcccagtcaagctgtttttgacgacgaagcagacaag
accggtgaactgagggacagtgatttcagtaatgaacaattctccaaactacctatgttt
ataaattcaggactagccatggatggcctgtttgatgacagcgaagatgaaagtgataaa
ctgagctacccttgggatggcacgcaatcctattcattgttcaatgtgtctccttcttgt
tcttcttttaactctccatgtagagattctgtgtcaccacccaaatccttattttctcaa
agaccccaaaggatgcgctctcgttcaaggtccttttctcgacacaggtcgtgttcccga
tcaccatattccaggtcaagatcaaggtctccaggcagtagatcctcttcaagatcctgc
tattactatgagtcaagccactacagacaccgcacgcaccgaaattctcccttgtatgtg
agatcacgttcaagatcgccctacagccgtcggcccaggtatgacagctacgaggaatat
cagcacgagaggctgaagagggaagaatatcgcagagagtatgagaagcgagagtctgag
agggccaagcaaagggagaggcagaggcagaaggcaattgaagagcgccgtgtgatttat
gtcggtaaaatcagacctgacacaacacggacagaactgagggaccgttttgaagttttt
ggtgaaattgaggagtgcacagtaaatctgcgggatgatggagacagctatggtttcatt
acctaccgttatacctgtgatgcttttgctgctcttgaaaatggatacactttgcgcagg
tcaaacgaaactgactttgagctgtacttttgtggacgcaagcaatttttcaagtctaac
tatgcagacctagattcaaactcagatgactttgaccctgcttccaccaagagcaagtat
gactctctggattttgatagtttactgaaagaagctcagagaagcttgcgcaggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system