KEGG   Homo sapiens (human): 10891Help
Entry
10891             CDS       T01001                                 

Gene name
PPARGC1A, LEM6, PGC-1(alpha), PGC-1v, PGC1, PGC1A, PPARGC1
Definition
peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Orthology
K07202  
alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Huntington's disease
Class
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p15.1
AA seq 798 aa AA seqDB search
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgggacatgtgcaaccaggactctgagtctgtatggagtgacatcgagtgtgct
gctctggttggtgaagaccagcctctttgcccagatcttcctgaacttgatctttctgaa
ctagatgtgaacgacttggatacagacagctttctgggtggactcaagtggtgcagtgac
caatcagaaataatatccaatcagtacaacaatgagccttcaaacatatttgagaagata
gatgaagagaatgaggcaaacttgctagcagtcctcacagagacactagacagtctccct
gtggatgaagacggattgccctcatttgatgcgctgacagatggagacgtgaccactgac
aatgaggctagtccttcctccatgcctgacggcacccctccaccccaggaggcagaagag
ccgtctctacttaagaagctcttactggcaccagccaacactcagctaagttataatgaa
tgcagtggtctcagtacccagaaccatgcaaatcacaatcacaggatcagaacaaaccct
gcaattgttaagactgagaattcatggagcaataaagcgaagagtatttgtcaacagcaa
aagccacaaagacgtccctgctcggagcttctcaaatatctgaccacaaacgatgaccct
cctcacaccaaacccacagagaacagaaacagcagcagagacaaatgcacctccaaaaag
aagtcccacacacagtcgcagtcacaacacttacaagccaaaccaacaactttatctctt
cctctgaccccagagtcaccaaatgaccccaagggttccccatttgagaacaagactatt
gaacgcaccttaagtgtggaactctctggaactgcaggcctaactccacccaccactcct
cctcataaagccaaccaagataacccttttagggcttctccaaagctgaagtcctcttgc
aagactgtggtgccaccaccatcaaagaagcccaggtacagtgagtcttctggtacacaa
ggcaataactccaccaagaaagggccggagcaatccgagttgtatgcacaactcagcaag
tcctcagtcctcactggtggacacgaggaaaggaagaccaagcggcccagtctgcggctg
tttggtgaccatgactattgccagtcaattaattccaaaacagaaatactcattaatata
tcacaggagctccaagactctagacaactagaaaataaagatgtctcctctgattggcag
gggcagatttgttcttccacagattcagaccagtgctacctgagagagactttggaggca
agcaagcaggtctctccttgcagcacaagaaaacagctccaagaccaggaaatccgagcc
gagctgaacaagcacttcggtcatcccagtcaagctgtttttgacgacgaagcagacaag
accggtgaactgagggacagtgatttcagtaatgaacaattctccaaactacctatgttt
ataaattcaggactagccatggatggcctgtttgatgacagcgaagatgaaagtgataaa
ctgagctacccttgggatggcacgcaatcctattcattgttcaatgtgtctccttcttgt
tcttcttttaactctccatgtagagattctgtgtcaccacccaaatccttattttctcaa
agaccccaaaggatgcgctctcgttcaaggtccttttctcgacacaggtcgtgttcccga
tcaccatattccaggtcaagatcaaggtctccaggcagtagatcctcttcaagatcctgc
tattactatgagtcaagccactacagacaccgcacgcaccgaaattctcccttgtatgtg
agatcacgttcaagatcgccctacagccgtcggcccaggtatgacagctacgaggaatat
cagcacgagaggctgaagagggaagaatatcgcagagagtatgagaagcgagagtctgag
agggccaagcaaagggagaggcagaggcagaaggcaattgaagagcgccgtgtgatttat
gtcggtaaaatcagacctgacacaacacggacagaactgagggaccgttttgaagttttt
ggtgaaattgaggagtgcacagtaaatctgcgggatgatggagacagctatggtttcatt
acctaccgttatacctgtgatgcttttgctgctcttgaaaatggatacactttgcgcagg
tcaaacgaaactgactttgagctgtacttttgtggacgcaagcaatttttcaagtctaac
tatgcagacctagattcaaactcagatgactttgaccctgcttccaccaagagcaagtat
gactctctggattttgatagtttactgaaagaagctcagagaagcttgcgcaggtaa

DBGET integrated database retrieval system