KEGG   Homo sapiens (human): 109Help
Entry
109               CDS       T01001                                 

Gene name
ADCY3, AC3
Definition
adenylate cyclase 3 (EC:4.6.1.1)
Orthology
K08043  
adenylate cyclase 3 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Olfactory transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
Vibrio cholerae infection
HTLV-I infection
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    109 (ADCY3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    109 (ADCY3)
   04020 Calcium signaling pathway
    109 (ADCY3)
   04024 cAMP signaling pathway
    109 (ADCY3)
   04022 cGMP - PKG signaling pathway
    109 (ADCY3)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    109 (ADCY3)
  Cellular commiunity
   04540 Gap junction
    109 (ADCY3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    109 (ADCY3)
   04062 Chemokine signaling pathway
    109 (ADCY3)
  Endocrine system
   04911 Insulin secretion
    109 (ADCY3)
   04912 GnRH signaling pathway
    109 (ADCY3)
   04913 Ovarian Steroidogenesis
    109 (ADCY3)
   04915 Estrogen signaling pathway
    109 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    109 (ADCY3)
   04921 Oxytocin signaling pathway
    109 (ADCY3)
   04918 Thyroid hormone synthesis
    109 (ADCY3)
   04916 Melanogenesis
    109 (ADCY3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109 (ADCY3)
   04270 Vascular smooth muscle contraction
    109 (ADCY3)
  Digestive system
   04970 Salivary secretion
    109 (ADCY3)
   04971 Gastric acid secretion
    109 (ADCY3)
   04972 Pancreatic secretion
    109 (ADCY3)
   04976 Bile secretion
    109 (ADCY3)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    109 (ADCY3)
  Nervous system
   04724 Glutamatergic synapse
    109 (ADCY3)
   04727 GABAergic synapse
    109 (ADCY3)
   04725 Cholinergic synapse
    109 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    109 (ADCY3)
  Sensory system
   04740 Olfactory transduction
    109 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    109 (ADCY3)
  Environmental adaptation
   04713 Circadian entrainment
    109 (ADCY3)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    109 (ADCY3)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    109 (ADCY3)
  Infectious diseases
   05110 Vibrio cholerae infection
    109 (ADCY3)
   05166 HTLV-I infection
    109 (ADCY3)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109 (ADCY3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 1144 aa AA seqDB search
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVLPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQV
VDNS
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgactttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctggcttccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtgctgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctcaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctt
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcttgcccgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcaccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaacgggagtgcccacagc
agtgggtccacgtcggagaagcccgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggatgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtccgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggccctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcatggtgggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcaacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccagcaatgcaacggcaggg
atggaaacggagggcagctgcctggagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcaggcgccgtggccaccatcaacctctatgcctggcgtcccgtctttgat
gaatacgaccacaagcgttttcgggagcacgacttacctatggtggccttagagcagatg
caaggattcaaccctgggctcaatggcactgacaggctgcccctggtgccttccaagtac
tctatgacggtgatggtgttcctcatgatgctcagcttctactacttctcccgccacgta
gaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaacgt
gtctatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtg
gcacgccatttcctggggtccaagaagagagatgaggagctgtatagccagacgtatgat
gagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagc
atcaacaatggtggtattgagtgtctgcgtttcctcaatgaaatcatctcagattttgac
tctctcctggacaatcccaagttccgggtgatcaccaagatcaaaaccattggcagcacg
tatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagctccaac
aaggaagacaagtccgagagagagcgctggcagcacctggctgacctggccgacttcgcg
ctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatgctg
cgcataggcatgaacaaaggcggggttctggctggggtcatcggagcccggaaaccacac
tacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtcatg
ggcaacattcaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgcttt
gtgaggcgaggccccatctttgtgaaggggaagggggagctgctgaccttcttcttgaag
gggcgggataagctagccaccttccccaatggcccctctgtcacactgccccaccaggtg
gtggacaactcctga

DBGET integrated database retrieval system