KEGG   Homo sapiens (human): 10908Help
Entry
10908             CDS       T01001                                 

Gene name
PNPLA6, BNHS, NTE, NTEMND, SPG39, iPLA2delta, sws
Definition
patatin-like phospholipase domain containing 6 (EC:3.1.1.5)
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Disease
H00266  
Hereditary spastic paraplegia (SPG)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    10908 (PNPLA6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     10908 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 1375 aa AA seqDB search
MEAPLQTGMMGTSSHGLATNSSGAKVAERDGFQDVLAPGEGSAGRICGAQPVPFVPQVLG
VMIGAGVAVVVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTS
SLVDTSVSATSRPRMRKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTEGDLANS
HLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLL
ELCLPGPDGKECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEA
FSAVFTKYPESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTR
TSPVRGSKRMVSTSATDEPRETPGRPPDPTGAPLPGPTGDPVKPTSLETPSAPLLSRCVS
MPGDISGLQGGPRSDFDMAYERGRISVSLQEEASGGSLAAPARTPTQEPREQPAGACEYS
YCEDESATGGCPFGPYQGRQTSSIFEAAKQELAKLMRIEDPSLLNSRVLLHHAKAGTIIA
RQGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQR
DCTFLRISKSDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQG
DRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTEL
AKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPAGSGLGVPPHSELTNPAS
NLATVAILPVCAEVPMVAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSG
WLAQQEDAHRIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRA
LKQLVLLHREEGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRR
ADRHSDFSRLARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIG
ALYAEERSASRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIE
DLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINN
LPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQ
SRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRG
NVIEKMLTDRRSTDLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDC
LTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSATDA
NT seq 4128 nt NT seq  +upstreamnt  +downstreamnt
atggaggctccgctgcaaactggaatgatggggacatcgagtcacgggctggctacgaac
tcctcgggggcgaaggtggcggagagggatgggttccaggacgtcctggcgcccggggaa
ggctcggcgggacggatttgcggtgcgcagccagtgccgttcgtccctcaggtgcttggc
gtgatgatcggggccggagtggcggtggtggtcacggccgtgctcatcctcctggtggtg
cggaggctgcgagtgccaaaaaccccagccccggatggcccccggtatcggttccggaag
agggacaaagtgctcttctatggccggaagattatgcggaaggtgtcacaatccacctcc
tccctcgtggatacctctgtctccgccacctcccggccacgcatgaggaagaaactgaag
atgctcaacattgccaagaagatcctgcgcatccagaaagagacgcccacgctgcagcgg
aaggagcccccgcccgcagtgctagaagctgacctgaccgagggcgacctggctaactcc
catctgccctctgaagtgctttatatgctcaagaacgtccgggtgctgggccacttcgag
aagccactcttcctggagctctgccgccacatggtcttccagcggctgggccagggtgac
tacgtcttccggccgggccagccagatgccagcatctacgtggtgcaggacgggctgctg
gagctctgtctgccagggcctgacgggaaggagtgtgtggtgaaggaagtggttcctggg
gacagcgtcaacagccttctcagcatcctggatgtcatcaccggtcaccagcatccccag
cggaccgtgtctgcccgggcggcccgggactccacggtgctgcgcctgccggtggaagca
ttctccgcggtcttcaccaagtacccggagagcttggtgcgggtcgtgcagatcatcatg
gtgcggctgcagcgagtcaccttcctggcactgcacaactacctgggtctgaccaatgag
ctcttcagccacgagatccagcccctgcgtctgttccccagccccggcctcccaactcgc
accagccctgtgcggggctccaagagaatggtcagcacctcagctacagacgagcccagg
gagaccccagggcggccacccgatcccaccggggccccgctgcctggacctacaggggac
cctgtgaagcccacatccctggaaaccccctcggcccctctgctgagccgctgcgtctcc
atgccaggggacatctcaggcttgcagggtggcccccgctccgacttcgacatggcctat
gagcgtggccggatctccgtgtccctgcaggaagaggcctccggggggtccctggcagcc
cccgctcggacccccactcaggagcctcgtgagcagccggcaggcgcctgtgaatacagc
tactgtgaggatgagtcggccactggtggctgccctttcgggccctaccagggccgccag
accagcagcatcttcgaggcagcaaagcaggagctggccaagctgatgcggattgaggac
ccctccctcctgaacagcagagtcttgctgcaccacgccaaagctggcaccatcattgcc
cgccagggagaccaggacgtgagcctgcacttcgtgctctggggctgcctgcacgtgtac
cagcgcatgatcgacaaggcggaggacgtgtgcctgttcgtagcgcagcccggggaactg
gtggggcagctggcggtgctcactggcgaacctctcatcttcacactgcgagcccaacgc
gactgcaccttcctgcggatctccaagtccgacttctatgagatcatgcgcgcacagccc
agtgtggtgctgagtgcggcgcacacggtggcagccaggatgtcgcccttcgtgcgccag
atggacttcgccatcgactggactgcagtggaggcgggacgcgcgctgtacaggcagggc
gaccgctccgactgcacttacatcgtgctcaatgggcggctgcgtagcgtgatccagcga
ggcagtggcaagaaggagctggtgggcgagtacggccgcggcgacctcatcggcgtggtg
gaggcactgacccggcagccgcgagccacgacggtgcacgcggtgcgcgacacggagctg
gccaagcttcccgagggcaccttgggtcacatcaaacgccggtacccgcaggtcgtgacc
cgccttatccacctactgagccagaaaattctagggaatttgcagcagctgcaaggaccc
ttcccagcaggctctgggttgggtgtgcccccacactcggaactcaccaacccagccagc
aacctggcaactgtggcaatcctgcctgtgtgtgctgaggtccccatggtggccttcacg
ctggagctgcagcacgccctgcaggccatcggtccgacgctactccttaacagtgacatc
atccgggcacgcctgggggcctccgcactggatagcatccaagagttccggctgtcaggg
tggctggcccagcaggaggatgcacaccgtatcgtactctaccagacggacgcctcgctg
acgccctggaccgtgcgctgcctgcgacaggccgactgcatcctcattgtgggcctgggg
gaccaggagcctaccctcggccagctggagcagatgctggagaacacggctgtgcgcgcc
cttaagcagctagtcctgctccaccgagaggagggcgcgggccccacgcgcaccgtggag
tggctaaatatgcgcagctggtgctcggggcacctgcacctgcgctgtccgcgccgcctc
ttttcgcgccgcagccctgccaagctgcatgagctctacgagaaggttttctccaggcgc
gcggaccggcacagcgacttctcccgcttggcgagggtgctcacggggaacaccattgcc
cttgtgctaggcgggggcggggccaggggctgctcgcacatcggagtactaaaggcatta
gaggaggcgggggtccccgtggacctggtgggcggcacgtccattggctctttcatcgga
gcgttgtacgcggaggagcgcagcgccagccgcacgaagcagcgggcccgggagtgggcc
aagagcatgacttcggtgctggaacctgtgttggacctcacgtacccagtcacctccatg
ttcactgggtctgcctttaaccgcagcatccatcgggtcttccaggataagcagattgag
gacctgtggctgccttacttcaacgtgaccacagatatcaccgcctcagccatgcgagtc
cacaaagatggctccctgtggcggtacgtgcgcgccagcatgacgctgtcgggctacctg
cccccgctgtgcgaccccaaggacgggcacctactcatggatggcggctacatcaacaat
ctgccagcggacatcgcccgcagcatgggtgccaaaacggtcatcgccattgacgtgggg
agccaggatgagacggacctcagcacctacggggacagcctgtccggctggtggctgctg
tggaagcggctgaatccctgggctgacaaggtaaaggttccagacatggctgaaatccag
tcccgcctggcctacgtgtcctgtgtgcggcagctagaggttgtcaagtccagctcctac
tgcgagtacctgcgcccgcccatcgactgcttcaagaccatggactttgggaagttcgac
cagatctatgatgtgggctaccagtacgggaaggcggtgtttggaggctggagccgtggc
aacgtcattgagaaaatgctcacagaccggcggtctacagaccttaatgagagccgccgt
gcagacgtgcttgccttcccaagctctggcttcactgacttggcagagattgtgtcccgg
attgagccccccacgagctatgtctctgatggctgtgctgacggagaggagtcagattgt
ctgacagagtatgaggaggacgccggacccgactgctcgagggatgaaggggggtccccc
gagggcgcaagccccagcactgcctccgagatggaggaggagaagtcgattctccggcaa
cgacgctgtctgccccaggagccgcccggctcagccacagatgcctga

DBGET integrated database retrieval system