KEGG   Homo sapiens (human): 10919Help
Entry
10919             CDS       T01001                                 

Gene name
EHMT2, BAT8, C6orf30, G9A, GAT8, KMT1C, NG36
Definition
euchromatic histone-lysine N-methyltransferase 2 (EC:2.1.1.43)
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    10919 (EHMT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     10919 (EHMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.31
AA seq 1233 aa AA seqDB search
MRGLPRGRGLMRARGRGRAAPPGSRGRGRGGPHRGRGRPRSLLSLPRAQASWTPQLSTGL
TSPPVPCLPSQGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLEPAG
PSSPASVTVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSPSKG
GSCPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRA
RKTMSKPGNGQPPVPEKRPPEIQHFRMSDDVHSLGKVTSDLAKRRKLNSGGGLSEELGSA
RRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALTEQLSEEEE
EEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKRE
PPRAKEPRGVSNDTSSLETERGFEELPLCSCRMEAPKIDRISERAGHKCMATESVDGELS
GCNAAILKRETMRPSSRVALMVLCETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAH
RFHKACVSQLNGMVFCPHCGEDASEAQEVTIPRGDGVTPPAGTAAPAPPPLSQDVPGRAD
TSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPLGPGREALEKALV
IQESERRKKLRFHPRQLYLSVKQGELQKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGS
VEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHH
AAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNE
ENICLHWASFTGSAAIAEVLLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANP
ELRNKEGDTAWDLTPERSDVWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPC
VNGVDGEPCPEDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYD
KDGRLLQEFNKIEPPLIFECNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQT
IPQGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDP
NIIPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKH
SAEAIALEQSRLARLDPHPELLPELGSLPPVNT
NT seq 3702 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtctaccgagagggagggggttgatgcgggcccgggggaggggtcgtgcggcc
cctccgggcagccgaggccgcggaaggggggggccccacagaggaagaggtaggccccgg
agcctactctctcttcccagggcccaggcatcctggaccccccaactctctactgggctg
accagccctcctgtcccttgtctcccctcccagggggaggcccccgctgagatgggggcg
ctgctgctggagaaggaaaccagaggagccaccgagagagttcatggctctttgggggac
acccctcgtagtgaagaaaccctgcccaaggccacccccgactccctggagcctgctggc
ccctcatctccagcctctgtcactgtcactgttggtgatgagggggctgacacccctgta
ggggctacaccactcattggggatgaatctgagaatcttgagggagatggggacctccgt
gggggccggatcctgctgggccatgccacaaagtcattcccctcttcccccagcaagggg
ggttcctgtcctagccgggccaagatgtcaatgacaggggcgggaaaatcacctccatct
gtccagagtttggctatgaggctactgagtatgccaggagcccagggagctgcagcagca
gggtctgaaccccctccagccaccacgagcccagagggacagcccaaggtccaccgagcc
cgcaaaaccatgtccaaaccaggaaatggacagcccccggtccctgagaagcggccccct
gaaatacagcatttccgcatgagtgatgatgtccactcactgggaaaggtgacctcagat
ctggccaaaaggaggaagctgaactcaggaggtggcctgtcagaggagttaggttctgcc
cggcgttcaggagaagtgaccctgacgaaaggggaccccgggtccctggaggagtgggag
acggtggtgggtgatgacttcagtctctactatgattcctactctgtggatgagcgcgtg
gactccgacagcaagtctgaagttgaagctctaactgaacaactaagtgaagaggaggag
gaggaagaggaggaagaagaagaagaggaagaggaggaggaagaggaagaagaagaggaa
gatgaggagtcagggaatcagtcagataggagtggttccagtggccggcgcaaggccaag
aagaaatggcgaaaagacagcccatgggtgaagccgtctcggaaacggcgcaagcgggag
cctccgcgggccaaggagccacgaggggtgtccaatgacacatcttcgctggagacagag
cgagggtttgaggagttgcccctgtgcagctgccgcatggaggcacccaagattgaccgc
atcagcgagagggcggggcacaagtgcatggccactgagagtgtggacggagagctgtca
ggctgcaatgccgccatcctcaagcgggagaccatgaggccatccagccgtgtggccctg
atggtgctctgtgagacccaccgcgcccgcatggtcaaacaccactgctgcccgggctgc
ggctacttctgcacggcgggcaccttcctggagtgccaccctgacttccgtgtggcccac
cgcttccacaaggcctgtgtgtctcagctgaatgggatggtcttctgtccccactgtggg
gaggatgcttctgaagctcaagaggtgaccatcccccggggtgacggggtgaccccaccg
gccggcactgcagctcctgcacccccacccctgtcccaggatgtccccgggagagcagac
acttctcagcccagtgcccggatgcgagggcatggggaaccccggcgcccgccctgcgat
cccctggctgacaccattgacagctcagggccctccctgaccctgcccaatgggggctgc
ctttcagccgtggggctgccactggggccaggccgggaggccctggaaaaggccctggtc
atccaggagtcagagaggcggaagaagctccgtttccaccctcggcagttgtacctgtcc
gtgaagcagggcgagctgcagaaggtgatcctgatgctgttggacaacctggaccccaac
ttccagagcgaccagcagagcaagcgcacgcccctgcatgcagccgcccagaagggctcc
gtggagatctgccatgtgctgctgcaggctggagccaacataaatgcagtggacaaacag
cagcggacgccactgatggaggccgtggtgaacaaccacctggaggtagcccgttacatg
gtgcagcgtggtggctgtgtctatagcaaggaggaggacggttccacctgcctccaccac
gcagccaaaatcgggaacttggagatggtcagcctgctgctgagcacaggacaggtggac
gtcaacgcccaggacagtggggggtggacgcccatcatctgggctgcagagcacaagcac
atcgaggtgatccgcatgctactgacgcggggcgccgacgtcaccctcactgacaacgag
gagaacatctgcctgcactgggcctccttcacgggcagcgccgccatcgccgaagtcctt
ctgaatgcgcgctgtgacctccatgctgtcaactaccatggggacacccccctgcacatc
gcagctcgggagagctaccatgactgcgtgctgttattcctgtcacgtggggccaaccct
gagctgcggaacaaagagggggacacagcatgggacctgactcccgagcgctccgacgtg
tggtttgcgcttcaactcaaccgcaagctccgacttggggtgggaaatcgggccatccgc
acagagaagatcatctgccgggacgtggctcggggctatgagaacgtgcccattccctgt
gtcaacggtgtggatggggagccctgccctgaggattacaagtacatctcagagaactgc
gagacgtccaccatgaacatcgatcgcaacatcacccacctgcagcactgcacgtgtgtg
gacgactgctctagctccaactgcctgtgcggccagctcagcatccggtgctggtatgac
aaggatgggcgattgctccaggaatttaacaagattgagcctccgctgattttcgagtgt
aaccaggcgtgctcatgctggagaaactgcaagaaccgggtcgtacagagtggcatcaag
gtgcggctacagctctaccgaacagccaagatgggctggggggtccgcgccctgcagacc
atcccacaggggaccttcatctgcgagtatgtcggggagctgatctctgatgctgaggct
gatgtgagagaggatgattcttacctcttcgacttagacaacaaggatggagaggtgtac
tgcatagatgcccgttactatggcaacatcagccgcttcatcaaccacctgtgtgacccc
aacatcattcccgtccgggtcttcatgctgcaccaagacctgcgatttccacgcatcgcc
ttcttcagttcccgagacatccggactggggaggagctagggtttgactatggcgaccgc
ttctgggacatcaaaagcaaatatttcacctgccaatgtggctctgagaagtgcaagcac
tcagccgaagccattgccctggagcagagccgtctggcccgcctggacccacaccctgag
ctgctgcccgagctcggctccctgccccctgtcaacacatga

DBGET integrated database retrieval system