KEGG   Homo sapiens (human): 10926Help
Entry
10926             CDS       T01001                                 

Gene name
DBF4, ASK, CHIF, DBF4A, ZDBF1
Definition
DBF4 zinc finger
Orthology
K06629  
activator of S phase kinase
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10926 (DBF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.3
AA seq 674 aa AA seqDB search
MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTI
SEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPH
PSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIE
QKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMP
FINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSP
VSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVD
HYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
EHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLT
AFFSSPSTSTFTGF
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaactccggagccatgaggatccacagtaaaggacatttccagggtggaatccaagtc
aaaaatgaaaaaaacagaccatctctgaaatctctgaaaactgataacaggccagaaaaa
tccaaatgtaagccactttggggaaaagtattttaccttgacttaccttctgtcaccata
tctgaaaaacttcaaaaggacattaaggatctgggagggcgagttgaagaatttctcagc
aaagatatcagttatcttatttcaaataagaaggaagctaaatttgcacaaaccttgggt
cgaatttctcctgtaccaagtccagaatctgcatatactgcagaaaccacttcacctcat
cccagccatgatggaagttcatttaagtcaccagacacagtgtgtttaagcagaggaaaa
ttattagttgaaaaagctatcaaggaccatgattttattccttcaaatagtatattatca
aatgccttgtcatggggagtaaaaattcttcatattgatgacattagatactacattgaa
caaaagaaaaaagagttgtatttactcaagaaatcaagtacttcagtaagagatgggggc
aaaagagttggtagtggtgcacaaaaaacaagaacaggaagactcaaaaagccttttgta
aaggtggaagatatgagccaactttataggccattttatcttcagctgaccaatatgcct
tttataaattattctattcagaagccctgcagtccatttgatgtagacaagccatctagt
atgcaaaagcaaactcaggttaaactaagaatccaaacagatggcgataagtatggtgga
acctcaattcaactccagttgaaagagaagaagaaaaaaggatattgtgaatgttgcttg
cagaaatatgaagatctagaaactcaccttctaagtgagcaacacagaaactttgcacag
agtaaccagtatcaagttgttgatgatattgtatctaagttagtttttgactttgtggaa
tatgaaaaggacacacctaaaaagaaaagaataaaatacagtgttggatccctttctcct
gtttctgcaagtgtcctgaaaaagactgaacaaaaggaaaaagtggaattgcaacatatt
tctcagaaagattgccaggaagatgatacaacagtgaaggagcagaatttcctgtataaa
gagacccaggaaactgaaaaaaagctcctgtttatttcagagcccatcccccacccttca
aatgaattgagagggcttaatgagaaaatgagtaataaatgttccatgttaagtacagct
gaagatgacataagacagaattttacacagctacctctacataaaaacaaacaggaatgc
attcttgacatttccgaacacacattaagtgaaaatgacttagaagaactaagggtagat
cactataaatgtaacatacaggcatctgtacatgtttctgatttcagtacagataatagt
ggatctcaaccaaaacagaagtcagatactgtgctttttccagcaaaggatctcaaggaa
aaggaccttcattcaatatttactcatgattctggtctgataacaataaacagttcacaa
gagcacctaactgttcaggcaaaggctccattccatactcctcctgaggaacccaatgaa
tgtgacttcaagaatatggatagtttaccttctggtaaaatacatcgaaaagtgaaaata
atattaggacgaaatagaaaagaaaatctggaaccaaatgctgaatttgataaaagaact
gaatttattacacaagaagaaaacagaatttgtagttcaccggtacagtctttactagac
ttgtttcagactagtgaagagaaatcagaatttttgggtttcacaagctacacagaaaag
agtggtatatgcaatgttttagatatttgggaagaggaaaattcagataatctgttaaca
gcgtttttctcgtccccttcaacttctacatttactggcttttag

DBGET integrated database retrieval system