KEGG   Homo sapiens (human): 10963Help
Entry
10963             CDS       T01001                                 

Gene name
STIP1, HEL-S-94n, HOP, IEF-SSP-3521, P60, STI1, STI1L
Definition
(RefSeq) stress induced phosphoprotein 1
  KO
K09553  
stress-induced-phosphoprotein 1
Organism
hsa  Homo sapiens (human)
Pathway
Prion diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    10963 (STIP1)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  Sti1 / p60
   10963 (STIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 543 aa AA seqDB search
MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYED
GCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLA
ERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLS
VLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKD
FDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIA
KAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLA
LEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHD
SPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLI
AIR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggtcaatgagctgaaggagaaaggcaacaaggccctgagcgtgggtaacatc
gatgatgccttacagtgctactccgaagctattaagctggatccccacaaccacgtgctg
tacagcaaccgttctgctgcctatgccaagaaaggagactaccagaaggcttatgaggat
ggctgcaagactgtcgacctaaagcctgactggggcaagggctattcacgaaaagcagca
gctctagagttcttaaaccgctttgaagaagccaagcgaacctatgaggagggcttaaaa
cacgaggcaaataaccctcaactgaaagagggtttacagaatatggaggccaggttggca
gagagaaaattcatgaaccctttcaacatgcctaatctgtatcagaagttggagagtgat
cccaggacaaggacactactcagtgatcctacctaccgggagctgatagagcagctacga
aacaagccttctgacctgggcacgaaactacaagatccccggatcatgaccactctcagc
gtcctccttggggtcgatctgggcagtatggatgaggaggaagagattgcaacacctcca
ccaccaccccctcccaaaaaggagaccaagccagagccaatggaagaagatcttccagag
aataagaagcaggcactgaaagaaaaagagctggggaacgatgcctacaagaagaaagac
tttgacacagccttgaagcattacgacaaagccaaggagctggaccccactaacatgact
tacattaccaatcaagcagcggtatactttgaaaagggcgactacaataagtgccgggag
ctttgtgagaaggccattgaagtggggagagaaaaccgagaagactatcgacagattgcc
aaagcatatgctcgaattggcaactcctacttcaaagaagaaaagtacaaggatgccatc
catttctataacaagtctctggcagagcaccgaaccccagatgtgctcaagaaatgccag
caggcagagaaaatcctgaaggagcaagagcggctggcctacataaaccccgacctggct
ttggaggagaagaacaaaggcaacgagtgttttcagaaaggggactatccccaggccatg
aagcattatacagaagccatcaaaaggaacccgaaagatgccaaattatacagcaatcga
gctgcctgctacaccaaactcctggagttccagctggcactcaaggactgtgaggaatgt
atccagctggagccgaccttcatcaagggttatacacggaaagccgctgcgctggaagcg
atgaaggactacaccaaagccatggatgtgtaccagaaggcgctagacctggactccagc
tgtaaggaggcggcagacggctaccagcgctgtatgatggcgcagtacaaccggcacgac
agccccgaagatgtgaagcgacgagccatggccgaccctgaggtgcagcagatcatgagt
gacccagccatgcgccttatcctggaacagatgcagaaggacccccaggcactcagcgaa
cacttaaagaatcctgtaatagcacagaagatccagaagctgatggatgtgggtctgatt
gcaattcggtga

DBGET integrated database retrieval system