KEGG   Homo sapiens (human): 10971Help
Entry
10971             CDS       T01001                                 

Gene name
YWHAQ, 14-3-3, 1C5, HS1
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    10971 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    10971 (YWHAQ)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10971 (YWHAQ)
   04114 Oocyte meiosis
    10971 (YWHAQ)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10971 (YWHAQ)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10971 (YWHAQ)
   05161 Hepatitis B
    10971 (YWHAQ)
   05169 Epstein-Barr virus infection
    10971 (YWHAQ)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    10971 (YWHAQ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   10971 (YWHAQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM
Motif
Other DBs
NCBI-GeneID: 10971
NCBI-ProteinID: NP_006817
OMIM: 609009
HGNC: 12854
Ensembl: ENSG00000134308
Vega: OTTHUMG00000013848
Pharos: P27348(Tbio)
UniProt: P27348
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 245 aa AA seqDB search
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagaagactgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggcagtgaccgagcagggcgccgagctgtccaacgaggag
cgcaacctgctctccgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctctagcatcgagcagaagaccgacacctccgacaagaagttgcagctgattaag
gactatcgggagaaagtggagtccgagctgagatccatctgcaccacggtgctggaattg
ttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggtgattacttccggtaccttgctgaagttgcgtgtggtgatgatcgaaaacaa
acgatagataattcccaaggagcttaccaagaggcatttgatataagcaagaaagagatg
caacccacacacccaatccgcctggggcttgctcttaacttttctgtattttactatgag
attcttaataacccagagcttgcctgcacgctggctaaaacggcttttgatgaggccatt
gctgaacttgatacactgaatgaagactcatacaaagacagcaccctcatcatgcagttg
cttagagacaacctaacactttggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggctgaaaactaa

DBGET integrated database retrieval system