KEGG   Homo sapiens (human): 11016Help
Entry
11016             CDS       T01001                                 

Gene name
ATF7, ATFA
Definition
(RefSeq) activating transcription factor 7
  KO
K09045  
activating transcription factor 7
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    11016 (ATF7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 483 aa AA seqDB search
MGDDRPFVCNAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARTDSVIIADQTPTPTRFLKN
CEEVGLFNELASSFEHEFKKAADEDEKKAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPD
SPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSLPLHLGYDPLHPTLPSPTSVITQAP
PSNRQMGSPTGSLPLVMHLANGQTMPVLPGPPVQMPSVISLARPVSMVPNIPGIPGPPVN
SSGSISPSGHPIPSEAKMRLKATLTHQVSSINGGCGMVVGTASTMVTARPEQSQILIQHP
DAPSPAQPQVSPAQPTPSTGGRRRRTVDEDPDERRQRFLERNRAAASRCRQKRKLWVSSL
EKKAEELTSQNIQLSNEVTLLRNEVAQLKQLLLAHKDCPVTALQKKTQGYLESPKESSEP
TGSPAPVIQHSSATAPSNGLSVRSAAEAVATSVLTQMASQRTELSMPIQSHVIMTPQSQS
AGR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgacagaccgtttgtgtgcaatgccccgggctgtggacagagatttacaaac
gaggaccacctggcagttcataaacacaagcatgagatgacattgaaatttggcccagcc
cgaactgactcagtcatcattgcagatcaaacgcctactccaactagattcctgaagaac
tgtgaggaggtgggactcttcaatgaactagctagctcctttgaacatgaattcaagaaa
gctgcagatgaggatgagaaaaaggctgctgctgggccccttgacatgtctctgccttcc
acaccagacatcaaaatcaaagaagaagagccagtggaggtagactcatccccacctgat
agccctgcctctagtccctgttccccaccactgaaggagaaggaggttaccccaaagcct
gttctgatctctacccccacacccaccattgtacgtcctggctccctgcctctccacttg
ggctatgatccacttcatccaacccttccctccccaacctctgtcatcacacaggctcca
ccatccaacaggcaaatggggtctcccactggctccctccctcttgtcatgcatcttgct
aatggacagaccatgcctgtgttgccagggcctccagtacagatgccgtctgttatatcg
ctggccagacctgtgtccatggtgcccaacattcctggtatccctggcccaccagttaac
agtagtggctccatttctccctctggccaccctataccatcagaagccaagatgagactg
aaagccaccctaactcaccaagtctcctcaatcaatggtggttgtggaatggtggtgggt
actgccagcaccatggtgacagcccgcccagagcagagccagattctcatccagcaccct
gatgccccatcccctgcccagccacaggtctcaccagctcagcccacccctagtactggg
gggcgacggcggcgcacagtagatgaagatccagatgagcgacggcagcgctttctggag
cgcaaccgggctgcagcctcccgctgccgccaaaagcgaaagctgtgggtgtcctcccta
gagaagaaggccgaagaactcacttctcagaacattcagctgagtaatgaagtcacatta
ctacgcaatgaggtggcccagttgaaacagctactgttagctcataaagactgcccagtc
actgcactacagaaaaagactcaaggctatttagaaagccccaaggaaagctcagagcca
acgggttctccagcccctgtgattcagcacagctcagcaacagcccctagcaatggcctc
agtgttcgctctgcagctgaagctgtggccacctcggtcctcactcagatggccagccaa
aggacagaactgagcatgccgatacaatcgcatgtaatcatgaccccacagtcccagtct
gcgggcagatga

DBGET integrated database retrieval system