KEGG   Homo sapiens (human): 11035Help
Entry
11035             CDS       T01001                                 

Gene name
RIPK3, RIP3
Definition
receptor-interacting serine-threonine kinase 3 (EC:2.7.11.1)
Orthology
K08847  
receptor-interacting serine/threonine-protein kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    11035 (RIPK3)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    11035 (RIPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     11035 (RIPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  RIPK family [OT]
   11035 (RIPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
14q11.2
AA seq 518 aa AA seqDB search
MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISRE
VKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRL
LKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPG
GTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRP
SLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSS
VPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLA
PSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgtcaagttatggcccagcggtgcccccgcccccttggtgtccatcgaggaa
ctggagaaccaggagctcgtcggcaaaggcgggttcggcacagtgttccgggcgcaacat
aggaagtggggctacgatgtggcggtcaagatcgtaaactcgaaggcgatatccagggag
gtcaaggccatggcaagtctggataacgaattcgtgctgcgcctagaaggggttatcgag
aaggtgaactgggaccaagatcccaagccggctctggtgactaaattcatggagaacggc
tccttgtcggggctgctgcagtcccagtgccctcggccctggccgctcctttgccgcctg
ctgaaagaagtggtgcttgggatgttttacctgcacgaccagaacccggtgctcctgcac
cgggacctcaagccatccaacgtcctgctggacccagagctgcacgtcaagctggcagat
tttggcctgtccacatttcagggaggctcacagtcagggacagggtccggggagccaggg
ggcaccctgggctacttggccccagaactgtttgttaacgtaaaccggaaggcctccaca
gccagtgacgtctacagcttcgggatcctaatgtgggcagtgcttgctggaagagaagtt
gagttgccaaccgaaccatcactcgtgtacgaagcagtgtgcaacaggcagaaccggcct
tcattggctgagctgccccaagccgggcctgagactcccggcttagaaggactgaaggag
ctaatgcagctctgctggagcagtgagcccaaggacagaccctccttccaggaatgccta
ccaaaaactgatgaagtcttccagatggtggagaacaatatgaatgctgctgtctccacg
gtaaaggatttcctgtctcagctcaggagcagcaataggagattttctatcccagagtca
ggccaaggagggacagaaatggatggctttaggagaaccatagaaaaccagcactctcgt
aatgatgtcatggtttctgagtggctaaacaaactgaatctagaggagcctcccagctct
gttcctaaaaaatgcccgagccttaccaagaggagcagggcacaagaggagcaggttcca
caagcctggacagcaggcacatcttcagattcgatggcccaacctccccagactccagag
acctcaactttcagaaaccagatgcccagccctacctcaactggaacaccaagtcctgga
ccccgagggaatcagggggctgagagacaaggcatgaactggtcctgcaggaccccggag
ccaaatccagtaacagggcgaccgctcgttaacatatacaactgctctggggtgcaagtt
ggagacaacaactacttgactatgcaacagacaactgccttgcccacatggggcttggca
ccttcgggcaaggggaggggcttgcagcaccccccaccagtaggttcgcaagaaggccct
aaagatcctgaagcctggagcaggccacagggttggtataatcatagcgggaaataa

DBGET integrated database retrieval system