KEGG   Homo sapiens (human): 11036Help
Entry
11036             CDS       T01001                                 

Gene name
GTF2A1L, ALF
Definition
(RefSeq) general transcription factor IIA 1 like
  KO
K03122  
transcription initiation factor TFIIA large subunit
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    11036 (GTF2A1L)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    11036 (GTF2A1L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     11036 (GTF2A1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p16.3
AA seq 478 aa AA seqDB search
MACLNPVPKLYRSVIEDVIEGVRNLFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNS
IQSPLFTLQLPHSLHQTLQSSTASLVIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVP
AGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHPIQQVFQQLGQPSVIQTSVPQLNPWSL
QATTEKSQRIETVLQQPAILPSGPVDRKHLENATSDILVSPGNEHKIVPEALLCHQESSH
YISLPGVVFSPQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILK
NRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQVDGSGDTSSNEE
IGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
DVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctcaacccggtgcctaaactctacagatctgtaattgaagatgtaattgaa
ggagttcggaatctatttgctgaagaaggtatagaggaacaagttttaaaagacttgaag
cagctctgggaaaccaaggttttgcagtctaaagcaacagaagacttcttcagaaatagc
atccaatcacctctgtttactcttcagttgccgcacagcttgcaccaaacattgcaatcg
tcaacagcatcattagttattcctgctggtagaactcttccaagttttaccacagcagaa
ctgggcacttcaaactccagtgcaaactttacttttcctggttatcccattcatgtacca
gcaggtgtgacactacagactgtatctggtcacctttataaagtcaatgtaccaattatg
gtgacagagacttctggaagagcaggtattcttcagcatccaattcagcaagtatttcaa
cagcttggccagccttcagtaatacaaactagtgttccacaattgaatccatggtctctt
caagcaactactgaaaaatcacagagaattgaaaccgtgctacagcaacccgcaattcta
ccttctgggccagtagataggaaacacttagaaaatgccaccagtgatatacttgtatct
cctggaaatgagcataaaatcgtgcctgaagctttgttgtgtcatcaggaaagttctcac
tatatcagtcttccaggtgttgtattttctccacaggtctctcaaacaaattctaatgtg
gagtcagtgctcagtggttcagctagcatggctcaaaatctgcatgatgagtccctctcc
acaagccctcatggggctctccaccagcacgtgactgatattcagcttcatattcttaaa
aataggatgtatggatgtgattctgtaaagcaaccaagaaatatagaggaacccagcaac
atacctgtatcagagaaggattctaattctcaggtggatttaagcattcgggttactgat
gatgatattggtgaaataattcaagtagatggaagcggtgatacatcttccaatgaagaa
ataggaagtacaagagatgcagatgagaatgaatttctagggaatattgacgggggagat
ctgaaggtacctgaagaagaagctgacagtatttcaaatgaggattcagccacaaacagt
agtgataatgaagaccctcaagtaaacattgtagaagaggaccctttaaattctggagat
gatgttagtgaacaggatgtgccagacctgtttgacacggataatgttattgtctgtcag
tatgataagattcatcgaagcaagaacaaatggaaattctatttgaaagatggtgttatg
tgttttggagggagagactatgtatttgcaaaagccattggtgatgcagagtggtaa

DBGET integrated database retrieval system