KEGG   Homo sapiens (human): 11036Help
Entry
11036             CDS       T01001                                 

Gene name
GTF2A1L, ALF
Definition
general transcription factor IIA, 1-like
Orthology
K03122  
transcription initiation factor TFIIA large subunit
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Viral carcinogenesis
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p16.3
AA seq 444 aa AA seqDB search
MACLNPVLWETKVLQSKATEDFFRNSIQSPLFTLQLPHSLHQTLQSSTASLVIPAGRTLP
SFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKVNVPIMVTETSGRAGILQHP
IQQVFQQLGQPSVIQTSVPQLNPWSLQATTEKSQRIETVLQQPAILPSGPVDRKHLENAT
SDILVSPGNEHKIVPEALLCHQESSHYISLPGVVFSPQVSQTNSNVESVLSGSASMAQNL
HDESLSTSPHGALHQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDL
SIRVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNE
DSATNSSDNEDPQVNIVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFY
LKDGVMCFGGRDYVFAKAIGDAEW
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctcaacccggtgctctgggaaaccaaggttttgcagtctaaagcaacagaa
gacttcttcagaaatagcatccaatcacctctgtttactcttcagttgccgcacagcttg
caccaaacattgcaatcgtcaacagcatcattagttattcctgctggtagaactcttcca
agttttaccacagcagaactgggcacttcaaactccagtgcaaactttacttttcctggt
tatcccattcatgtaccagcaggtgtgacactacagactgtatctggtcacctttataaa
gtcaatgtaccaattatggtgacagagacttctggaagagcaggtattcttcagcatcca
attcagcaagtatttcaacagcttggccagccttcagtaatacaaactagtgttccacaa
ttgaatccatggtctcttcaagcaactactgaaaaatcacagagaattgaaaccgtgcta
cagcaacccgcaattctaccttctgggccagtagataggaaacacttagaaaatgccacc
agtgatatacttgtatctcctggaaatgagcataaaatcgtgcctgaagctttgttgtgt
catcaggaaagttctcactatatcagtcttccaggtgttgtattttctccacaggtctct
caaacaaattctaatgtggagtcagtgctcagtggttcagctagcatggctcaaaatctg
catgatgagtccctctccacaagccctcatggggctctccaccagcacgtgactgatatt
cagcttcatattcttaaaaataggatgtatggatgtgattctgtaaagcaaccaagaaat
atagaggaacccagcaacatacctgtatcagagaaggattctaattctcaggtggattta
agcattcgggttactgatgatgatattggtgaaataattcaagtagatggaagcggtgat
acatcttccaatgaagaaataggaagtacaagagatgcagatgagaatgaatttctaggg
aatattgacgggggagatctgaaggtacctgaagaagaagctgacagtatttcaaatgag
gattcagccacaaacagtagtgataatgaagaccctcaagtaaacattgtagaagaggac
cctttaaattctggagatgatgttagtgaacaggatgtgccagacctgtttgacacggat
aatgttattgtctgtcagtatgataagattcatcgaagcaagaacaaatggaaattctat
ttgaaagatggtgttatgtgttttggagggagagactatgtatttgcaaaagccattggt
gatgcagagtggtaa

DBGET integrated database retrieval system