KEGG   Homo sapiens (human): 11041Help
Entry
11041             CDS       T01001                                 

Gene name
B4GAT1, B3GN-T1, B3GNT1, B3GNT6, BETA3GNTI, MDDGA13, iGAT, iGNT
Definition
(RefSeq) beta-1,4-glucuronyltransferase 1
  KO
K21032  
beta-1,4-glucuronyltransferase 1 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Mannose type O-glycan biosynthesis
Metabolic pathways
Disease
H00120  
Muscular dystrophy-dystroglycanopathy type A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    11041 (B4GAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     11041 (B4GAT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   11041 (B4GAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O43505(Tbio)
UniProt: 
Position
11q13.2
AA seq 415 aa AA seqDB search
MQMSYAIRCAFYQLLLAALMLVAMLQLLYLSLLSGLHGQEEQDQYFEFFPPSPRSVDQVK
AQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPL
SVSVFAATKEEAQLATVLAYALSSHCPDMRARVAMHLVCPSRYEAAVPDPREPGEFALLR
SCQEVFDKLARVAQPGINYALGTNVSYPNNLLRNLAREGANYALVIDVDMVPSEGLWRGL
REMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCQAPTN
YSRWVNLPEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAG
FDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgtcctacgccatccggtgcgccttctaccagctgctgctggccgcgctcatg
ctggtggcgatgctgcagctgctctacctgtcgctgctgtccggactgcacgggcaggag
gagcaagaccaatattttgagttctttcccccgtccccacggtccgtggaccaggtcaag
gcgcagctccgcaccgcgctggcctctggaggcgtcctggacgctagcggcgattaccgc
gtctacaggggcctgctgaagaccaccatggaccccaacgatgtgatcctggccacgcac
gccagcgtggacaacctgctgcacctgtcgggtctgctggagcgctgggagggcccgctg
tccgtgtcggtgttcgcggccaccaaggaggaggcgcagctggccacggtgctggcctac
gcgctgagcagccactgccccgacatgcgcgccagggtcgccatgcacctcgtgtgcccc
tcgcgttacgaggcagccgtgcccgacccccgggagccgggggagtttgccctgctgcgg
tcctgccaggaggtctttgacaagctagccagggtggcccagcccgggattaattatgcg
ctgggcaccaatgtctcctaccccaataacctgctgaggaatctggctcgtgagggggcc
aactatgccctggtgatcgatgtggacatggtgcccagcgaggggctgtggagaggcctg
cgggaaatgctggatcagagcaaccagtggggaggcaccgcgctggtggtgcctgccttc
gaaatccgaagagcccgccgcatgcccatgaacaaaaacgagctggtgcagctctaccag
gttggcgaggtgcggcccttctattatgggttgtgcaccccctgccaggcacccaccaac
tattcccgctgggtcaacctgccggaagagagcttgctgcggcccgcctacgtggtacct
tggcaggacccctgggagccattctacgtggcaggaggcaaggtgcccaccttcgacgag
cgctttcggcagtacggcttcaaccgaatcagccaggcctgcgagctgcatgtggcgggg
tttgattttgaggtcctgaacgaaggtttcttggttcataagggcttcaaagaagcgttg
aagttccatccccaaaaggaggctgaaaatcagcacaataagatcctatatcgccagttc
aaacaggagttgaaggccaagtaccccaactctccccgacgctgctga

DBGET integrated database retrieval system