KEGG   Homo sapiens (human): 11060Help
Entry
11060             CDS       T01001                                 

Gene name
WWP2, AIP2, WWp2-like
Definition
WW domain containing E3 ubiquitin protein ligase 2
Orthology
K05630  
atrophin-1 interacting protein 2 (WW domain containing E3 ubiquitin protein ligase 2) [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q22.1
AA seq 754 aa AA seqDB search
MQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPE
NRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVN
DEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAA
QAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTT
TWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQD
NGRVYYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPR
PGFESGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMK
PYDLRRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASS
INPDHLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIV
WIKENNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRG
VEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQI
QWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSH
TCFNRLDLPPYKSYEQLREKLLYAIEETEGFGQE
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaccctgaacctgcagacggagaacaaaggcagcgttgtctcaggcggagag
ctgacaattttcctggacgggccaactgttgatctgggaaatgtgcctaatggcagtgcc
ctgacagatggatcacagctgccttcgagagactccagtggaacagcagtagctccagag
aaccggcaccagccccccagcacaaactgctttggtggaagatcccggacgcacagacat
tcgggtgcttcagccagaacaaccccagcaaccggcgagcaaagccccggtgctcggagc
cggcaccgccagcccgtcaagaactcaggccacagtggcttggccaatggcacagtgaat
gatgaacccacaacagccactgatcccgaagaaccttccgttgttggtgtgacgtcccca
cctgctgcacccttgagtgtgaccccgaatcccaacacgacttctctccctgccccagcc
acaccggctgaaggagaggaacccagcacttcgggtacacagcagctcccagcggctgcc
caggcccccgacgctctgcctgctggatgggaacagcgagagctgcccaacggacgtgtc
tattatgttgaccacaataccaagaccaccacctgggagcggccccttcctccaggctgg
gaaaaacgcacagatccccgaggcaggttttactatgtggatcacaatactcggaccacc
acctggcagcgtccgaccgcggagtacgtgcgcaactatgagcagtggcagtcgcagcgg
aatcagctccagggggccatgcagcacttcagccaaagattcctctaccagtcttcgagt
gcttcgactgaccatgatcccctgggccccctccctcctggctgggagaagagacaggac
aatggacgggtgtattacgtgaaccataacactcgcacgacccagtgggaggatccccgg
acccaggggatgatccaggaaccagctctgcccccaggatgggagatgaaatacaccagc
gagggggtgcgatactttgtggaccacaatacccgcaccaccacctttaaggatcctcgc
ccggggtttgagtcggggacgaagcaaggttcccctggtgcttatgaccgcagttttcgg
tggaagtatcaccagttccgtttcctctgccattcaaatgccctacctagccacgtgaag
atcagcgtttccaggcagacgcttttcgaagattccttccaacagatcatgaacatgaaa
ccctatgacctgcgccgccggctctacatcatcatgcgtggcgaggagggcctggactat
gggggcatcgccagagagtggtttttcctcctgtctcatgaggtgctcaaccctatgtat
tgtttatttgaatatgccggaaagaacaattactgcctgcagatcaaccccgcctcctcc
atcaacccggaccacctcacctactttcgctttataggcagattcatcgccatggcgctg
taccatggaaagttcatcgacacgggcttcaccctccctttctacaagcggatgctcaat
aagagaccaaccctgaaagacctggagtccattgaccctgagttctacaactccattgtc
tggatcaaagagaacaacctggaagaatgtggcctggagctgtacttcatccaggacatg
gagatactgggcaaggtgacgacccacgagctgaaggagggcggcgagagcatccgggtc
acagaggagaacaaggaagagtacatcatgctgctgactgactggcgtttcacccgaggc
gtggaagagcagaccaaagccttcctggatggcttcaacgaggtggccccgctggagtgg
ctgcgctactttgacgagaaagagctggagctgatgctgtgcggcatgcaggagatagac
atgagcgactggcagaagagcaccatctaccggcactacaccaagaacagcaagcagatc
cagtggttctggcaggtggtgaaggagatggacaacgagaagaggatccggctgctgcag
tttgtcaccggtacctgccgcctgcccgtcgggggatttgccgaactcatcggtagcaac
ggaccacagaagttttgcattgacaaagttggcaaggaaacctggctgcccagaagccac
acctgcttcaaccgtctggatcttccaccctacaagagctacgaacagctgagagagaag
ctgctgtatgccattgaggagaccgagggctttggacaggagtaa

DBGET integrated database retrieval system