KEGG   Homo sapiens (human): 11060Help
Entry
11060             CDS       T01001                                 

Gene name
WWP2, AIP2, WWp2-like
Definition
(RefSeq) WW domain containing E3 ubiquitin protein ligase 2
  KO
K05630  
atrophin-1 interacting protein 2 (WW domain containing E3 ubiquitin protein ligase 2) [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    11060 (WWP2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     11060 (WWP2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   11060 (WWP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q22.1
AA seq 870 aa AA seqDB search
MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRI
GSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLT
LNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQ
PPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPT
TATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPD
ALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQR
PTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTDHDPLGPLPPGWEKRQDNGRV
YYVNHNTRTTQWEDPRTQGMIQEPALPPGWEMKYTSEGVRYFVDHNTRTTTFKDPRPGFE
SGTKQGSPGAYDRSFRWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNMKPYDL
RRRLYIIMRGEEGLDYGGIAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPD
HLTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYNSIVWIKE
NNLEECGLELYFIQDMEILGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQ
TKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRHYTKNSKQIQWFW
QVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELIGSNGPQKFCIDKVGKETWLPRSHTCFN
RLDLPPYKSYEQLREKLLYAIEETEGFGQE
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgccagctctagccgggcaggagtggccctgccttttgagaagtctcagctc
actttgaaagtggtgtccgcaaagcccaaggtgcataatcgtcaacctcgaattaactcc
tacgtggaggtggcggtggatggactccccagtgagaccaagaagactgggaagcgcatt
gggagctctgagcttctctggaatgagatcatcattttgaatgtcacggcacagagtcat
ttagatttaaaggtctggagctgccataccttgagaaatgaactgctaggcaccgcatct
gtcaacctctccaacgtcttgaagaacaatgggggcaaaatggagaacatgcagctgacc
ctgaacctgcagacggagaacaaaggcagcgttgtctcaggcggagagctgacaattttc
ctggacgggccaactgttgatctgggaaatgtgcctaatggcagtgccctgacagatgga
tcacagctgccttcgagagactccagtggaacagcagtagctccagagaaccggcaccag
ccccccagcacaaactgctttggtggaagatcccggacgcacagacattcgggtgcttca
gccagaacaaccccagcaaccggcgagcaaagccccggtgctcggagccggcaccgccag
cccgtcaagaactcaggccacagtggcttggccaatggcacagtgaatgatgaacccaca
acagccactgatcccgaagaaccttccgttgttggtgtgacgtccccacctgctgcaccc
ttgagtgtgaccccgaatcccaacacgacttctctccctgccccagccacaccggctgaa
ggagaggaacccagcacttcgggtacacagcagctcccagcggctgcccaggcccccgac
gctctgcctgctggatgggaacagcgagagctgcccaacggacgtgtctattatgttgac
cacaataccaagaccaccacctgggagcggccccttcctccaggctgggaaaaacgcaca
gatccccgaggcaggttttactatgtggatcacaatactcggaccaccacctggcagcgt
ccgaccgcggagtacgtgcgcaactatgagcagtggcagtcgcagcggaatcagctccag
ggggccatgcagcacttcagccaaagattcctctaccagtcttcgagtgcttcgactgac
catgatcccctgggccccctccctcctggctgggagaagagacaggacaatggacgggtg
tattacgtgaaccataacactcgcacgacccagtgggaggatccccggacccaggggatg
atccaggaaccagctctgcccccaggatgggagatgaaatacaccagcgagggggtgcga
tactttgtggaccacaatacccgcaccaccacctttaaggatcctcgcccggggtttgag
tcggggacgaagcaaggttcccctggtgcttatgaccgcagttttcggtggaagtatcac
cagttccgtttcctctgccattcaaatgccctacctagccacgtgaagatcagcgtttcc
aggcagacgcttttcgaagattccttccaacagatcatgaacatgaaaccctatgacctg
cgccgccggctctacatcatcatgcgtggcgaggagggcctggactatgggggcatcgcc
agagagtggtttttcctcctgtctcatgaggtgctcaaccctatgtattgtttatttgaa
tatgccggaaagaacaattactgcctgcagatcaaccccgcctcctccatcaacccggac
cacctcacctactttcgctttataggcagattcatcgccatggcgctgtaccatggaaag
ttcatcgacacgggcttcaccctccctttctacaagcggatgctcaataagagaccaacc
ctgaaagacctggagtccattgaccctgagttctacaactccattgtctggatcaaagag
aacaacctggaagaatgtggcctggagctgtacttcatccaggacatggagatactgggc
aaggtgacgacccacgagctgaaggagggcggcgagagcatccgggtcacagaggagaac
aaggaagagtacatcatgctgctgactgactggcgtttcacccgaggcgtggaagagcag
accaaagccttcctggatggcttcaacgaggtggccccgctggagtggctgcgctacttt
gacgagaaagagctggagctgatgctgtgcggcatgcaggagatagacatgagcgactgg
cagaagagcaccatctaccggcactacaccaagaacagcaagcagatccagtggttctgg
caggtggtgaaggagatggacaacgagaagaggatccggctgctgcagtttgtcaccggt
acctgccgcctgcccgtcgggggatttgccgaactcatcggtagcaacggaccacagaag
ttttgcattgacaaagttggcaaggaaacctggctgcccagaagccacacctgcttcaac
cgtctggatcttccaccctacaagagctacgaacagctgagagagaagctgctgtatgcc
attgaggagaccgagggctttggacaggagtaa

DBGET integrated database retrieval system