KEGG   Homo sapiens (human): 111Help
Entry
111               CDS       T01001                                 

Gene name
ADCY5, AC5, FDFM
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01522  Endocrine resistance
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04114  Oocyte meiosis
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04270  Vascular smooth muscle contraction
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing's syndrome
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05012  Parkinson's disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05414  Dilated cardiomyopathy (DCM)
Module
hsa_M00695  cAMP signaling
Drug target
Colforsin daropate hydrochloride: D01697
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    111 (ADCY5)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    111 (ADCY5)
   04371 Apelin signaling pathway
    111 (ADCY5)
   04072 Phospholipase D signaling pathway
    111 (ADCY5)
   04024 cAMP signaling pathway
    111 (ADCY5)
   04022 cGMP - PKG signaling pathway
    111 (ADCY5)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    111 (ADCY5)
  Cellular community - eukaryotes
   04540 Gap junction
    111 (ADCY5)
 Organismal Systems
  Immune system
   04611 Platelet activation
    111 (ADCY5)
   04062 Chemokine signaling pathway
    111 (ADCY5)
  Endocrine system
   04911 Insulin secretion
    111 (ADCY5)
   04923 Regulation of lipolysis in adipocyte
    111 (ADCY5)
   04912 GnRH signaling pathway
    111 (ADCY5)
   04913 Ovarian Steroidogenesis
    111 (ADCY5)
   04915 Estrogen signaling pathway
    111 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    111 (ADCY5)
   04921 Oxytocin signaling pathway
    111 (ADCY5)
   04926 Relaxin signaling pathway
    111 (ADCY5)
   04918 Thyroid hormone synthesis
    111 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    111 (ADCY5)
   04916 Melanogenesis
    111 (ADCY5)
   04924 Renin secretion
    111 (ADCY5)
   04925 Aldosterone synthesis and secretion
    111 (ADCY5)
   04927 Cortisol synthesis and secretion
    111 (ADCY5)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111 (ADCY5)
   04270 Vascular smooth muscle contraction
    111 (ADCY5)
  Digestive system
   04970 Salivary secretion
    111 (ADCY5)
   04971 Gastric acid secretion
    111 (ADCY5)
   04972 Pancreatic secretion
    111 (ADCY5)
   04976 Bile secretion
    111 (ADCY5)
  Nervous system
   04724 Glutamatergic synapse
    111 (ADCY5)
   04727 GABAergic synapse
    111 (ADCY5)
   04725 Cholinergic synapse
    111 (ADCY5)
   04728 Dopaminergic synapse
    111 (ADCY5)
   04726 Serotonergic synapse
    111 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    111 (ADCY5)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111 (ADCY5)
  Aging
   04211 Longevity regulating pathway - mammal
    111 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    111 (ADCY5)
  Environmental adaptation
   04713 Circadian entrainment
    111 (ADCY5)
   04714 Thermogenesis
    111 (ADCY5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    111 (ADCY5)
  Neurodegenerative diseases
   05012 Parkinson's disease
    111 (ADCY5)
  Substance dependence
   05030 Cocaine addiction
    111 (ADCY5)
   05031 Amphetamine addiction
    111 (ADCY5)
   05032 Morphine addiction
    111 (ADCY5)
   05034 Alcoholism
    111 (ADCY5)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    111 (ADCY5)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    111 (ADCY5)
  Infectious diseases
   05166 HTLV-I infection
    111 (ADCY5)
  Drug resistance
   01522 Endocrine resistance
    111 (ADCY5)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA HILPDA DUF2339
Motif
Other DBs
NCBI-GeneID: 111
NCBI-ProteinID: NP_899200
OMIM: 600293
HGNC: 236
Ensembl: ENSG00000173175
Vega: OTTHUMG00000159517
Pharos: O95622(Tchem)
UniProt: O95622 B7Z2C7
Position
3q21.1
AA seq 1261 aa AA seqDB search
MSGSKSVSPPGYAAQKTAAPAPRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGA
VTPQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQRR
GAASGGSTRAPPAGGGGGSAAAAASAGGTEVRPRSVEVGLEERRGKGRAADELEAGAVEG
GEGSGDGGSSADSGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQS
SLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILIMAVLCNRAAFHQDHMGL
ACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSAL
HLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARLH
SQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTS
LASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEM
GMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK
AGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMN
RQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFL
GRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQI
TIVPHSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVF
TITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSP
WPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNADL
LVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKL
QATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANF
SEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTY
DKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWG
NTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPL
S
NT seq 3786 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctccaaaagcgtgagccccccgggctacgcggcgcagaagactgcggcgccg
gcgccccggggaggccccgaacaccgctctgcgtggggcgaggccgattcccgcgcgaat
ggctacccccatgcccccgggggctctgcccgcggctccaccaagaaacccgggggggcg
gtgaccccgcagcagcagcagcgcctggccagccgctggcgcagcgacgacgacgacgat
cctccgctgagcggtgacgaccccctggccgggggcttcggcttcagcttccgctccaag
tccgcctggcaggagcgcggcggcgacgactgcggtcgcggcagccgccggcagcggcgg
ggcgcggccagcgggggcagcacccgggcgccccctgcgggcggcggcggcggctcggcg
gcggcggctgcctcggcgggcgggacggaggtgcgccctcgctcggtggaggtgggtctg
gaggagcggcggggcaaggggcgcgcggccgacgagctggaggccggcgccgtcgagggc
ggcgaggggtccggggatggcggcagctcggcggactcgggctcgggcgcggggcccggc
gcggtgctgtccctgggcgcctgctgcctggcgttgctgcagatattccgctccaagaag
ttcccgtcggacaaactggagcggctgtaccagcgctacttcttccgcctgaaccagagc
agcctcaccatgctcatggccgtgctggtgctcgtgtgcctggtcatgttggccttccac
gcggcgcggcccccgctccagctgccctacctggccgtgctggcggccgccgtcggcgtg
atcctcatcatggctgtgctttgcaaccgcgccgccttccaccaggaccacatgggcctg
gcctgctatgcgctcatcgccgtggtgctggccgtccaggtggtgggcctgctgctgccg
cagccacgcagcgcctctgagggcatctggtggaccgtgttcttcatctacaccatctac
acgctgctgcccgtgcgcatgcgggccgcagtgctcagcggggtgctcctgtccgccctc
cacctggccatcgccctgcgcaccaacgcccaggaccagttcctgctgaagcagcttgtc
tccaatgttctcattttctcctgcaccaacatcgtgggtgtctgcacccactatccggct
gaggtctcccagagacaggctttccaggagacccgagagtgcatccaggcgcggctccac
tcgcagcgggagaaccagcagcaggaacggctcctgctgtctgtccttccccgtcatgtt
gccatggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccataagatt
tacatccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcaccagc
ctggcgtcccagtgcactgcacaggaactggtcatgaccctcaacgagctcttcgcccgc
tttgacaagctggccgcagagaatcactgtttacgtattaagatccttggggattgttat
tactgcgtctcggggctgcctgaagcaagggctgaccacgcccactgctgtgtggagatg
ggcatggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtgaac
atgcgtgtgggaattcacagcgggcgagtacactgcggtgtccttggtctcaggaagtgg
cagttcgacgtctggtctaacgatgtcacgctagccaaccacatggaggctggcggcaag
gcaggacgcatccacatcaccaaggctacactcaactacctgaatggggactacgaggtg
gagccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagaccttc
ctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatgaac
cgccagagaaccaactccatcgggcacaacccaccacactggggggctgagcgccccttc
tacaaccacctgggtggcaaccaggtgtccaaggagatgaagcggatgggctttgaagac
cccaaggacaagaacgcccaggagagtgcgaaccctgaggatgaagtggatgagtttctg
ggccgtgccattgacgccaggagcattgataggcttcggtctgagcacgtccgcaagttc
ctcctgaccttcagggagcctgacttagagaagaagtactccaagcaggtagacgaccga
tttggtgcctatgtggcgtgtgcctcgctcgtcttcctcttcatctgctttgtccagatc
accatcgtgccccactccatattcatgctcagcttctacctgacctgttccctgctgctg
accttggtggtgtttgtgtctgtgatctactcctgcgtaaagctcttcccctccccactg
cagaccctctccaggaagatcgtgcggtccaagatgaacagcaccctggttggggtgttc
accatcaccctggtgttcctggcggcttttgtcaacatgttcacgtgcaactccagggac
ctgctgggctgcttggcacaggagcacaacatcagcgcgagccaggtcaacgcgtgtcac
gtggcggagtcggccgtcaactacagcctgggcgatgagcagggcttctgtggcagcccc
tggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctggcc
tgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgag
ctcatctacgtgctcatcgtggaggtgccaggtgtcacgctcttcgacaacgccgacctg
ctggtcaccgccaacgccatagacttcttcaacaacgggacctcccagtgccctgagcat
gcaaccaaggtggcattgaaggtggtgacgcccatcatcatctcagtctttgtgctggcc
ctgtacctgcacgcccagcaggtggagtccactgcccgcctcgacttcctctggaaactg
caggccacagaggagaaagaggagatggaggagctgcaggcctacaaccggcggctgctg
cacaacatcctgcccaaggacgtggccgctcacttcctggcccgcgagcggcgcaatgat
gagctctactatcagtcctgtgagtgtgtggcggtcatgttcgcctccatcgccaacttc
tccgagttctacgttgagctggaggccaacaacgagggtgtcgagtgcctgcggctactc
aatgagatcatcgctgactttgatgagatcatcagcgaggatcggttccggcagctggag
aagatcaagaccatcggcagcacctacatggctgcctccggcctcaacgactctacctac
gacaaggtgggcaagacccacatcaaggcactggccgactttgccatgaagctgatggac
cagatgaagtacatcaatgagcactccttcaacaacttccagatgaagatcgggctcaac
atcggccccgtggtggccggggtgataggggcacgaaagcctcagtacgacatctggggc
aataccgtgaacgtggccagccgcatggacagcaccggtgtacccgaccgcatccaggtc
accacagacatgtaccaggtgctggctgccaacacgtaccagctggagtgccggggcgtg
gtcaaggtcaagggcaaaggcgagatgatgacctacttcctcaatggagggcccccgctc
agttag

DBGET integrated database retrieval system