KEGG   Homo sapiens (human): 111Help
Entry
111               CDS       T01001                                 

Gene name
ADCY5, AC5, FDFM
Definition
adenylate cyclase 5 (EC:4.6.1.1)
Orthology
K08045  
adenylate cyclase 5 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Parkinson's disease
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
HTLV-I infection
Pathways in cancer
Dilated cardiomyopathy
Module
cAMP signaling
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    111 (ADCY5)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    111 (ADCY5)
   04024 cAMP signaling pathway
    111 (ADCY5)
   04022 cGMP - PKG signaling pathway
    111 (ADCY5)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    111 (ADCY5)
  Cellular commiunity
   04540 Gap junction
    111 (ADCY5)
 Organismal Systems
  Immune system
   04611 Platelet activation
    111 (ADCY5)
   04062 Chemokine signaling pathway
    111 (ADCY5)
  Endocrine system
   04911 Insulin secretion
    111 (ADCY5)
   04912 GnRH signaling pathway
    111 (ADCY5)
   04913 Ovarian Steroidogenesis
    111 (ADCY5)
   04915 Estrogen signaling pathway
    111 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    111 (ADCY5)
   04921 Oxytocin signaling pathway
    111 (ADCY5)
   04918 Thyroid hormone synthesis
    111 (ADCY5)
   04916 Melanogenesis
    111 (ADCY5)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    111 (ADCY5)
   04270 Vascular smooth muscle contraction
    111 (ADCY5)
  Digestive system
   04970 Salivary secretion
    111 (ADCY5)
   04971 Gastric acid secretion
    111 (ADCY5)
   04972 Pancreatic secretion
    111 (ADCY5)
   04976 Bile secretion
    111 (ADCY5)
  Nervous system
   04724 Glutamatergic synapse
    111 (ADCY5)
   04727 GABAergic synapse
    111 (ADCY5)
   04725 Cholinergic synapse
    111 (ADCY5)
   04728 Dopaminergic synapse
    111 (ADCY5)
   04726 Serotonergic synapse
    111 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    111 (ADCY5)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    111 (ADCY5)
  Environmental adaptation
   04713 Circadian entrainment
    111 (ADCY5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    111 (ADCY5)
  Neurodegenerative diseases
   05012 Parkinson's disease
    111 (ADCY5)
  Substance dependence
   05030 Cocaine addiction
    111 (ADCY5)
   05031 Amphetamine addiction
    111 (ADCY5)
   05032 Morphine addiction
    111 (ADCY5)
   05034 Alcoholism
    111 (ADCY5)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    111 (ADCY5)
  Infectious diseases
   05166 HTLV-I infection
    111 (ADCY5)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111 (ADCY5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21.1
AA seq 911 aa AA seqDB search
MKSQKEGCCSRGDLSIQTGPGGEWAPRRLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQE
TRECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSI
LFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEAR
ADHAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVT
LANHMEAGGKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRK
EEKAMIAKMNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESA
NPEDEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASL
VFLFICFVQITIVPHSIFMLSFYLTCSLLLTLVVFVSVIYSCVKLFPSPLQTLSRKIVRS
KMNSTLVGVFTITLVFLAAFVNMFTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSL
GDEQGFCGSPWPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVP
GVTLFDNADLLVTANAIDFFNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVES
TARLDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECV
AVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYM
AASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIG
ARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMM
TYFLNGGPPLS
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcagaaagagggctgttgcagcagaggtgacctgtccattcagacaggtcct
ggaggagaatgggccccacggaggcttgtctccaatgttctcattttctcctgcaccaac
atcgtgggtgtctgcacccactatccggctgaggtctcccagagacaggctttccaggag
acccgagagtgcatccaggcgcggctccactcgcagcgggagaaccagcagcaggaacgg
ctcctgctgtctgtccttccccgtcatgttgccatggagatgaaagcagacatcaacgcc
aagcaggaggatatgatgttccataagatttacatccagaaacatgacaacgtgagcatc
ctgtttgctgacatcgagggcttcaccagcctggcgtcccagtgcactgcacaggaactg
gtcatgaccctcaacgagctcttcgcccgctttgacaagctggccgcagagaatcactgt
ttacgtattaagatccttggggattgttattactgcgtctcggggctgcctgaagcaagg
gctgaccacgcccactgctgtgtggagatgggcatggacatgatcgaggccatctcgttg
gtccgggaggtgacaggggtgaacgtgaacatgcgtgtgggaattcacagcgggcgagta
cactgcggtgtccttggtctcaggaagtggcagttcgacgtctggtctaacgatgtcacg
ctagccaaccacatggaggctggcggcaaggcaggacgcatccacatcaccaaggctaca
ctcaactacctgaatggggactacgaggtggagccaggctgtgggggcgagcgcaacgcc
tacctcaaggagcacagtatcgagaccttcctcatcctgcgctgcacccagaagcggaaa
gaagagaaggccatgatcgccaagatgaaccgccagagaaccaactccatcgggcacaac
ccaccacactggggggctgagcgccccttctacaaccacctgggtggcaaccaggtgtcc
aaggagatgaagcggatgggctttgaagaccccaaggacaagaacgcccaggagagtgcg
aaccctgaggatgaagtggatgagtttctgggccgtgccattgacgccaggagcattgat
aggcttcggtctgagcacgtccgcaagttcctcctgaccttcagggagcctgacttagag
aagaagtactccaagcaggtagacgaccgatttggtgcctatgtggcgtgtgcctcgctc
gtcttcctcttcatctgctttgtccagatcaccatcgtgccccactccatattcatgctc
agcttctacctgacctgttccctgctgctgaccttggtggtgtttgtgtctgtgatctac
tcctgcgtaaagctcttcccctccccactgcagaccctctccaggaagatcgtgcggtcc
aagatgaacagcaccctggttggggtgttcaccatcaccctggtgttcctggcggctttt
gtcaacatgttcacgtgcaactccagggacctgctgggctgcttggcacaggagcacaac
atcagcgcgagccaggtcaacgcgtgtcacgtggcggagtcggccgtcaactacagcctg
ggcgatgagcagggcttctgtggcagcccctggcccaactgcaacttccccgagtacttc
acctacagcgtgctgctcagcctgctggcctgctccgtgttcctgcagatcagctgcatc
gggaagctggtgctcatgctggccatcgagctcatctacgtgctcatcgtggaggtgcca
ggtgtcacgctcttcgacaacgccgacctgctggtcaccgccaacgccatagacttcttc
aacaacgggacctcccagtgccctgagcatgcaaccaaggtggcattgaaggtggtgacg
cccatcatcatctcagtctttgtgctggccctgtacctgcacgcccagcaggtggagtcc
actgcccgcctcgacttcctctggaaactgcaggccacagaggagaaagaggagatggag
gagctgcaggcctacaaccggcggctgctgcacaacatcctgcccaaggacgtggccgct
cacttcctggcccgcgagcggcgcaatgatgagctctactatcagtcctgtgagtgtgtg
gcggtcatgttcgcctccatcgccaacttctccgagttctacgttgagctggaggccaac
aacgagggtgtcgagtgcctgcggctactcaatgagatcatcgctgactttgatgagatc
atcagcgaggatcggttccggcagctggagaagatcaagaccatcggcagcacctacatg
gctgcctccggcctcaacgactctacctacgacaaggtgggcaagacccacatcaaggca
ctggccgactttgccatgaagctgatggaccagatgaagtacatcaatgagcactccttc
aacaacttccagatgaagatcgggctcaacatcggccccgtggtggccggggtgataggg
gcacgaaagcctcagtacgacatctggggcaataccgtgaacgtggccagccgcatggac
agcaccggtgtacccgaccgcatccaggtcaccacagacatgtaccaggtgctggctgcc
aacacgtaccagctggagtgccggggcgtggtcaaggtcaagggcaaaggcgagatgatg
acctacttcctcaatggagggcccccgctcagttag

DBGET integrated database retrieval system