KEGG   Homo sapiens (human): 1111Help
Entry
1111              CDS       T01001                                 

Gene name
CHEK1, CHK1
Definition
checkpoint kinase 1 (EC:2.7.11.1)
Orthology
K02216  
serine/threonine-protein kinase Chk1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
HTLV-I infection
Viral carcinogenesis
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1111 (CHEK1)
   04115 p53 signaling pathway
    1111 (CHEK1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1111 (CHEK1)
  Infectious diseases
   05166 HTLV-I infection
    1111 (CHEK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1111 (CHEK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   1111 (CHEK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.2
AA seq 476 aa AA seqDB search
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgccctttgtggaagactgggacttggtgcaaaccctgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagagtaactgaagaagcagtcgcagtgaagattgta
gatatgaagcgtgccgtagactgtccagaaaatattaagaaagagatctgtatcaataaa
atgctaaatcatgaaaatgtagtaaaattctatggtcacaggagagaaggcaatatccaa
tatttatttctggagtactgtagtggaggagagctttttgacagaatagagccagacata
ggcatgcctgaaccagatgctcagagattcttccatcaactcatggcaggggtggtttat
ctgcatggtattggaataactcacagggatattaaaccagaaaatcttctgttggatgaa
agggataacctcaaaatctcagactttggcttggcaacagtatttcggtataataatcgt
gagcgtttgttgaacaagatgtgtggtactttaccatatgttgctccagaacttctgaag
agaagagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtacttactgca
atgctcgctggagaattgccatgggaccaacccagtgacagctgtcaggagtattctgac
tggaaagaaaaaaaaacatacctcaacccttggaaaaaaatcgattctgctcctctagct
ctgctgcataaaatcttagttgagaatccatcagcaagaattaccattccagacatcaaa
aaagatagatggtacaacaaacccctcaagaaaggggcaaaaaggccccgagtcacttca
ggtggtgtgtcagagtctcccagtggattttctaagcacattcaatccaatttggacttc
tctccagtaaacagtgcttctagtgaagaaaatgtgaagtactccagttctcagccagaa
ccccgcacaggtctttccttatgggataccagcccctcatacattgataaattggtacaa
gggatcagcttttcccagcccacatgtcctgatcatatgcttttgaatagtcagttactt
ggcaccccaggatcctcacagaacccctggcagcggttggtcaaaagaatgacacgattc
tttaccaaattggatgcagacaaatcttatcaatgcctgaaagagacttgtgagaagttg
ggctatcaatggaagaaaagttgtatgaatcaggttactatatcaacaactgataggaga
aacaataaactcattttcaaagtgaatttgttagaaatggatgataaaatattggttgac
ttccggctttctaagggtgatggattggagttcaagagacacttcctgaagattaaaggg
aagctgattgatattgtgagcagccagaagatttggcttcctgccacatga

DBGET integrated database retrieval system