KEGG   Homo sapiens (human): 1111Help
Entry
1111              CDS       T01001                                 

Gene name
CHEK1, CHK1
Definition
(RefSeq) checkpoint kinase 1
  KO
K02216  
serine/threonine-protein kinase Chk1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
Cellular senescence
HTLV-I infection
Viral carcinogenesis
Module
DNA damage-induced cell cycle checkpoints
Drug target
Rabusertib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1111 (CHEK1)
   04115 p53 signaling pathway
    1111 (CHEK1)
   04218 Cellular senescence
    1111 (CHEK1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1111 (CHEK1)
  Infectious diseases
   05166 HTLV-I infection
    1111 (CHEK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     1111 (CHEK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   1111 (CHEK1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    1111 (CHEK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O14757(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.2
AA seq 476 aa AA seqDB search
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgccctttgtggaagactgggacttggtgcaaaccctgggagaaggtgcctat
ggagaagttcaacttgctgtgaatagagtaactgaagaagcagtcgcagtgaagattgta
gatatgaagcgtgccgtagactgtccagaaaatattaagaaagagatctgtatcaataaa
atgctaaatcatgaaaatgtagtaaaattctatggtcacaggagagaaggcaatatccaa
tatttatttctggagtactgtagtggaggagagctttttgacagaatagagccagacata
ggcatgcctgaaccagatgctcagagattcttccatcaactcatggcaggggtggtttat
ctgcatggtattggaataactcacagggatattaaaccagaaaatcttctgttggatgaa
agggataacctcaaaatctcagactttggcttggcaacagtatttcggtataataatcgt
gagcgtttgttgaacaagatgtgtggtactttaccatatgttgctccagaacttctgaag
agaagagaatttcatgcagaaccagttgatgtttggtcctgtggaatagtacttactgca
atgctcgctggagaattgccatgggaccaacccagtgacagctgtcaggagtattctgac
tggaaagaaaaaaaaacatacctcaacccttggaaaaaaatcgattctgctcctctagct
ctgctgcataaaatcttagttgagaatccatcagcaagaattaccattccagacatcaaa
aaagatagatggtacaacaaacccctcaagaaaggggcaaaaaggccccgagtcacttca
ggtggtgtgtcagagtctcccagtggattttctaagcacattcaatccaatttggacttc
tctccagtaaacagtgcttctagtgaagaaaatgtgaagtactccagttctcagccagaa
ccccgcacaggtctttccttatgggataccagcccctcatacattgataaattggtacaa
gggatcagcttttcccagcccacatgtcctgatcatatgcttttgaatagtcagttactt
ggcaccccaggatcctcacagaacccctggcagcggttggtcaaaagaatgacacgattc
tttaccaaattggatgcagacaaatcttatcaatgcctgaaagagacttgtgagaagttg
ggctatcaatggaagaaaagttgtatgaatcaggttactatatcaacaactgataggaga
aacaataaactcattttcaaagtgaatttgttagaaatggatgataaaatattggttgac
ttccggctttctaagggtgatggattggagttcaagagacacttcctgaagattaaaggg
aagctgattgatattgtgagcagccagaagatttggcttcctgccacatga

DBGET integrated database retrieval system