KEGG   Homo sapiens (human): 11128Help
Entry
11128             CDS       T01001                                 

Gene name
POLR3A, ADDH, HLD7, RPC1, RPC155, hRPC155
Definition
polymerase (RNA) III (DNA directed) polypeptide A, 155kDa (EC:2.7.7.6)
Orthology
K03018  
DNA-directed RNA polymerase III subunit RPC1 [EC:2.7.7.6]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Cytosolic DNA-sensing pathway
Epstein-Barr virus infection
Module
RNA polymerase III, eukaryotes
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:hsa03020]
Organismal Systems; Immune system; Cytosolic DNA-sensing pathway [PATH:hsa04623]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22-q23
AA seq 1390 aa AA seqDB search
MVKEQFRETDVAKKISHICFGMKSPEEMRQQAHIQVVSKNLYSQDNQHAPLLYGVLDHRM
GTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQE
EKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYK
TNKKVVDPIVSNFLQSFETAIEHNKEVEPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLM
NPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISG
AKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPKKWTRGFVQRLKGKQGRFRGNLSGKR
VDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQNGPEVHPGANF
IQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARV
KPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIA
AIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQI
FSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSK
NNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAG
YKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTM
ALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYS
GLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQF
IYGGDGLDPAAMEGKDEPLEFKRVLDNIKAVFPCPSEPALSKNELILTTESIMKKSEFLC
CQDSFLQEIKKFIKGVSEKIKKTRDKYGINDNGTTEPRVLYQLDRITPTQVEKFLETCRD
KYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAI
STPIITAQLDKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLL
RLEVNAETVRYSICTSKLRVKPGDVAVHGEAVVCVTPRENSKSSMYYVLQFLKEDLPKVV
VQGIPEVSRAVIHIDEQSGKEKYKLLVEGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGI
EAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLAS
FEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFD
TNEFHIPLVT
NT seq 4173 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggagcagttccgggagacggatgtggccaagaaaataagccacatctgtttt
ggaatgaagtcacctgaggagatgcgccagcaggcgcacatccaagttgtgagtaagaac
ctgtacagccaggacaaccaacatgcccccttgctatatggggtgctcgaccataggatg
ggtacgagtgagaaggatcgtccatgtgaaacctgtgggaaaaacttggctgactgtcta
ggccactatgggtatatcgacctggagttgccgtgttttcatgtagggtacttcagagca
gtcataggcatcttacagatgatctgcaaaacctgctgccacatcatgctgtcccaagag
gagaagaagcagtttctggactatctaaagaggcccggcctgacctaccttcagaagcga
ggactgaaaaagaaaatctctgacaagtgccggaagaaaaacatctgccatcactgtggc
gcttttaatggtaccgtaaagaagtgtggactgctgaaaataattcatgagaaatacaag
accaacaaaaaagtggtggatcccattgtatcaaatttccttcagtcttttgaaacagcc
attgaacataataaagaagtggagcctctgctgggaagggcacaggaaaacttgaatccc
ttagtagttctgaatttatttaaacgaatcccagctgaagatgttcctctacttctgatg
aacccagaagccggaaagccgtctgatttgattctcacacgacttttggtgcctcctttg
tgtatcagaccctccgttgtgagtgatttgaagtctggcaccaatgaagatgatctgaca
atgaaactgacagaaatcattttcctaaacgatgttattaaaaagcatcggatctcagga
gccaagacccagatgatcatggaggactgggatttcctgcagctgcagtgtgccctctac
attaacagtgagctctcgggcattcccctcaacatggcacccaagaagtggaccagaggc
ttcgtccaacgcctgaagggaaaacagggtcgatttagaggaaatctctcaggaaagaga
gtggatttttctggcagaacagtcatctcgcccgaccccaacctccggattgatgaggta
gctgtgccagttcatgtggccaaaattctaacttttcctgagaaggtaaacaaagcaaac
atcaatttcttgaggaaactggttcaaaacggccctgaggttcacccaggagcaaacttc
attcagcagagacatacgcagatgaaaaggtttttgaaatacggaaatcgagaaaagatg
gctcaagagctcaagtatggtgacatcgtagagagacacctcatcgatggagatgtggtg
ctgttcaatcggcagccctcgctgcacaaattgagcattatggctcatctggccagggtc
aagccccaccggaccttcagatttaatgagtgtgtctgtacaccctataatgctgacttt
gatggtgatgaaatgaaccttcatcttcctcaaacagaagaagctaaagcagaggccctt
gttctgatggggactaaagcaaatcttgtaaccccgaggaatggggaaccgctgattgct
gctattcaggattttctaacaggtgcctatctcctcactctcaaggacactttctttgat
cgagccaaggcttgccaaatcattgcttcaatactggttggcaaggatgagaaaattaaa
gttcgcctcccaccgcctacaatcctaaagcctgtcaccctgtggacgggaaagcagatc
ttcagtgtcatcctcaggcctagcgatgacaatccagtgagggccaacctgcgaaccaag
ggcaagcagtactgtggcaaaggggaagatctctgtgccaatgattcctatgttacaatc
cagaacagtgagttgatgagtggcagcatggacaaaggaaccctagggtcaggatccaag
aacaatattttttacattttgctgcgagactggggacagaatgaagctgcagatgccatg
tcacggctcgccaggctggctcctgtctacctgtctaaccgtggtttctcaattgggatc
ggtgatgtcacacctggccaaggactgctgaaggccaagtatgagttgctgaatgccggc
tacaagaaatgtgatgagtacatcgaagccctgaacacgggcaagctgcagcagcagcct
ggctgcactgctgaggagaccctggaggcactgatcctgaaggagctgtctgtgatccgt
gaccacgctggcagtgcctgcctccgggagctggacaagagcaacagccccctcaccatg
gctctgtgcggctccaaaggttccttcattaacatatcacagatgattgcctgtgtggga
cagcaggccatcagtggctctcgagtgccagacggctttgaaaacaggtccttgcctcat
tttgaaaaacactcaaagctcccagctgccaaaggctttgtggctaatagcttttattcc
ggtttgacaccaactgagtttttcttccacacaatggccggccgggaaggtctagtcgac
acggctgtaaagacagctgaaacgggatacatgcagcgaaggcttgtcaaatctcttgaa
gatctttgctcccagtatgatctgacagtccgaagctctactggcgatattatccagttc
atttatggaggagatggcttagatcctgcagctatggagggaaaagatgaacctttggag
tttaaaagggttctggacaacatcaaagcagtcttcccgtgtcccagtgagcctgctctc
agcaaaaacgagctgatcctgaccacagagtccatcatgaagaagagtgagttcctctgc
tgccaggacagcttcctgcaggaaataaaaaaattcattaagggggtctctgagaagatc
aagaaaaccagagataaatatggcatcaatgataacggcacaacagagccccgtgtgctg
taccagctggaccgcatcacccccacccaagtagaaaagtttctggagacctgtagggac
aagtacatgagggcacagatggagccaggttctgcagtgggtgctctgtgtgcccagagc
attggtgagccaggcacccagatgaccctgaagactttccactttgcaggtgtggcctcc
atgaacatcaccctgggcgtgccccggattaaagagatcatcaacgcttccaaggccatc
agcactccaattatcacagcacagctagacaaggatgacgacgcggattatgctcgcctc
gtgaaagggagaattgagaaaaccctcttgggagagatttccgagtatattgaagaagtg
tttcttcctgatgactgctttattctcgtcaagctctccctggaacggattaggcttctg
agactggaagtgaacgctgagacagtgagatattccatctgcacatccaagctccgtgtg
aagcccggtgatgtggctgttcatggtgaggctgtggtgtgtgtcacccccagagagaac
agcaagagctccatgtactacgtgctgcagttcctgaaagaggatctccccaaggtggtg
gtgcagggcattccagaggtgtccagagctgtcatccacattgacgagcagagtggaaag
gagaagtacaagcttctggtggaaggtgataacctgcgggcagtcatggccacacacggt
gtgaagggcacccgaaccacctccaataacacctatgaggtggagaaaactctgggcatc
gaggccgcccggacaacgatcatcaatgaaatccagtacaccatggtgaaccacggcatg
agcatcgacaggaggcacgtgatgctgctctccgacctcatgacctacaagggtgaagtc
ctgggcatcactaggtttggcctggccaagatgaaggagagtgtgctgatgctggcctcc
tttgagaagacggctgaccatctctttgacgctgcctacttcgggcagaaggactctgtg
tgtggggtgtctgagtgcatcatcatgggaatcccaatgaacattggaaccgggctcttc
aagctgcttcacaaggctgacagggacccgaaccctcccaagaggcccctgatcttcgac
acaaatgaattccacatcccccttgtcacatag

DBGET integrated database retrieval system