KEGG   Homo sapiens (human): 11141Help
Entry
11141             CDS       T01001                                 

Gene name
IL1RAPL1, IL1R8, IL1RAPL, MRX10, MRX21, MRX34, OPHN4, TIGIRR-2
Definition
interleukin 1 receptor accessory protein-like 1
Orthology
K05170  
interleukin 1 receptor accessory protein-like
Organism
hsa  Homo sapiens (human)
Disease
H00480  
Non-syndromic X-linked mental retardation
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp22.1-p21.3
AA seq 696 aa AA seqDB search
MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYI
RTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVI
RNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEIL
WYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDK
PPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWE
SDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVEL
AGGLGAILLLLVCLVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWN
QETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPN
YVVRRGWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWH
GPKCNKLNSKFWKRLQYEMPFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTAL
ATAHPDLRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQ
RPQTKSSREQNPDEAHTNSAILPLLPRETSISSVIW
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctccgattccacacttgattctcttatacgctacttttactcagagtttgaag
gttgtgaccaaaagaggctccgccgatggatgcactgactggtctatcgatatcaagaaa
tatcaagttttggtgggagagcctgttcgaatcaaatgtgcactcttttatggttatatc
agaacaaattactcccttgcccaaagtgctggactcagtttgatgtggtacaaaagttct
ggtcctggagactttgaagagccaatagcctttgacggaagtagaatgagcaaagaagaa
gactccatttggttccggccaacattgctacaggacagtggtctctacgcctgtgtcatc
agaaactccacttactgtatgaaagtatccatctcactgacagtgggtgaaaatgacact
ggactctgctataattccaagatgaagtattttgaaaaagctgaacttagcaaaagcaag
gaaatttcatgccgtgacatagaggattttctactgccaaccagagaacctgaaatcctt
tggtacaaggaatgcaggacaaaaacatggaggccaagtattgtattcaaaagagatact
ctgcttataagagaagtcagagaagatgacattggaaattatacctgtgaattaaaatat
ggaggctttgttgtgagaagaactactgaattaactgttacagcccctctgactgataag
ccacccaagcttttgtatcctatggaaagtaaactgacaattcaggagacccagctgggt
gactctgctaatctaacctgcagagctttctttgggtacagcggagatgtcagtccttta
atttactggatgaaaggagaaaaatttattgaagatctggatgaaaatcgagtttgggaa
agtgacattagaattcttaaggagcatcttggggaacaggaagtttccatctcattaatt
gtggactctgtggaagaaggtgacttgggaaattactcctgttatgttgaaaatggaaat
ggacgtcgacacgccagcgttctccttcataaacgagagctaatgtacacagtggaactt
gctggaggccttggtgctatactcttgctgcttgtatgtttggtgaccatctacaagtgt
tacaagatagaaatcatgctcttctacaggaatcattttggagctgaagagctcgatgga
gacaataaagattatgatgcatacttatcatacaccaaagtggatcctgaccagtggaat
caagagactggggaagaagaacgttttgcccttgaaatcctacctgatatgcttgaaaag
cattatggatataagttgtttataccagatagagatttaatcccaactggaacatacatt
gaagatgtggcaagatgtgtagatcaaagcaagcggctgattattgtcatgaccccaaat
tacgtagttagaaggggctggagcatctttgagctggaaaccagacttcgaaatatgctt
gtgactggagaaattaaagtgattctaattgaatgcagtgaactgagaggaattatgaac
taccaggaggtggaggccctgaagcacaccatcaagctcctgacggtcattaaatggcat
ggaccaaaatgcaacaagttgaactccaagttctggaaacgtttacagtatgaaatgcct
tttaagaggatagaacccattacacatgagcaggctttagatgtcagtgagcaagggcct
tttggggagctgcagactgtctcggccatttccatggccgcggccacctccacagctcta
gccactgcccatccagatctccgttctacctttcacaacacgtaccattcacaaatgcgt
cagaaacactactaccgaagctatgagtacgacgtacctcctaccggcaccctgcctctt
acctccataggcaatcagcatacctactgtaacatccctatgacactcatcaacgggcag
cggccacagacaaaatcgagcagggagcagaatccagatgaggcccacacaaacagtgcc
atcctgccgctgttgccaagggagaccagtatatccagtgtgatatggtga

DBGET integrated database retrieval system