KEGG   Homo sapiens (human): 11145Help
Entry
11145             CDS       T01001                                 

Gene name
PLA2G16, AdPLA, H-REV107-1, HRASLS3, HREV107, HREV107-1, HREV107-3, HRSL3
Definition
phospholipase A2, group XVI (EC:3.1.1.4 3.1.1.32)
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:hsa00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:hsa00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:hsa00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:hsa00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.3
AA seq 162 aa AA seqDB search
MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIV
KKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL
RYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgcccattccagagcctaagcctggagacctgattgagatttttcgccctttc
tacagacactgggccatctatgttggcgatggatatgtggttcatctggcccctccaagt
gaggtcgcaggagctggtgcagccagtgtcatgtccgccctgactgacaaggccatcgtg
aagaaggaattgctgtatgatgtggccgggagtgacaagtaccaggtcaacaacaaacat
gatgacaagtactcgccgctgccctgcagcaaaatcatccagcgggcggaggagctggtg
gggcaggaggtgctctacaagctgaccagtgagaactgcgagcactttgtgaatgagctg
cgctatggagtcgcccgcagtgaccaggtcagagatgtcatcatcgctgcaagcgttgca
ggaatgggcttggcagccatgagccttattggagtcatgttctcaagaaacaagcgacaa
aagcaataa

DBGET integrated database retrieval system