KEGG   Homo sapiens (human): 11151Help
Entry
11151             CDS       T01001                                 

Gene name
CORO1A, CLABP, CLIPINA, HCORO1, IMD8, TACO, p57
Definition
coronin, actin binding protein, 1A
Orthology
K13882  
coronin-1A
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    11151 (CORO1A)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    11151 (CORO1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11151 (CORO1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 461 aa AA seqDB search
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFL
VLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPL
REPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIY
SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFS
RMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSE
APFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQ
EDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE
ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccggccaag
gccgaccagtgctatgaagatgtgcgcgtctcacagaccacctgggacagtggcttctgt
gctgtcaaccctaagtttgtggccctgatctgtgaggccagcgggggaggggccttcctg
gtgctgcccctgggcaagactggacgtgtggacaagaatgcgcccacggtctgtggccac
acagcccctgtgctagacatcgcctggtgcccgcacaatgacaacgtcattgccagtggc
tccgaggactgcacagtcatggtgtgggagatcccagatgggggcctgatgctgcccctg
cgggagcccgtcgtcaccctggagggccacaccaagcgtgtgggcattgtggcctggcac
accacagcccagaacgtgctgctcagtgcaggttgtgacaacgtgatcatggtgtgggac
gtgggcactggggcggccatgctgacactgggcccagaggtgcacccagacacgatctac
agtgtggactggagccgagatggaggcctcatttgtacctcctgccgtgacaagcgcgtg
cgcatcatcgagccccgcaaaggcactgtcgtagctgagaaggaccgtccccacgagggg
acccggcccgtgcgtgcagtgttcgtgtcggaggggaagatcctgaccacgggcttcagc
cgcatgagtgagcggcaggtggcgctgtgggacacaaagcacctggaggagccgctgtcc
ctgcaggagctggacaccagcagcggtgtcctgctgcccttctttgaccctgacaccaac
atcgtctacctctgtggcaagggtgacagctcaatccggtactttgagatcacttccgag
gcccctttcctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggc
tacatgcccaaacgtggcctggaggtgaacaagtgtgagatcgccaggttctacaagctg
cacgagcggaggtgtgagcccattgccatgacagtgcctcgaaagtcggacctgttccag
gaggacctgtacccacccaccgcagggcccgaccctgccctcacggctgaggagtggctg
gggggtcgggatgctgggcccctcctcatctccctcaaggatggctacgtacccccaaag
agccgggagctgagggtcaaccggggcctggacaccgggcgcaggagggcagcaccagag
gccagtggcactcccagctcggatgccgtgtctcggctggaggaggagatgcggaagctc
caggccacggtgcaggagctccagaagcgcttggacaggctggaggagacagtccaggcc
aagtag

DBGET integrated database retrieval system