KEGG   Homo sapiens (human): 11151Help
Entry
11151             CDS       T01001                                 

Gene name
CORO1A, CLABP, CLIPINA, HCORO1, IMD8, TACO, p57
Definition
coronin, actin binding protein, 1A
Orthology
K13882  
coronin-1A
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 461 aa AA seqDB search
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFL
VLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPL
REPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIY
SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFS
RMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSE
APFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQ
EDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE
ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccggccaag
gccgaccagtgctatgaagatgtgcgcgtctcacagaccacctgggacagtggcttctgt
gctgtcaaccctaagtttgtggccctgatctgtgaggccagcgggggaggggccttcctg
gtgctgcccctgggcaagactggacgtgtggacaagaatgcgcccacggtctgtggccac
acagcccctgtgctagacatcgcctggtgcccgcacaatgacaacgtcattgccagtggc
tccgaggactgcacagtcatggtgtgggagatcccagatgggggcctgatgctgcccctg
cgggagcccgtcgtcaccctggagggccacaccaagcgtgtgggcattgtggcctggcac
accacagcccagaacgtgctgctcagtgcaggttgtgacaacgtgatcatggtgtgggac
gtgggcactggggcggccatgctgacactgggcccagaggtgcacccagacacgatctac
agtgtggactggagccgagatggaggcctcatttgtacctcctgccgtgacaagcgcgtg
cgcatcatcgagccccgcaaaggcactgtcgtagctgagaaggaccgtccccacgagggg
acccggcccgtgcgtgcagtgttcgtgtcggaggggaagatcctgaccacgggcttcagc
cgcatgagtgagcggcaggtggcgctgtgggacacaaagcacctggaggagccgctgtcc
ctgcaggagctggacaccagcagcggtgtcctgctgcccttctttgaccctgacaccaac
atcgtctacctctgtggcaagggtgacagctcaatccggtactttgagatcacttccgag
gcccctttcctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggc
tacatgcccaaacgtggcctggaggtgaacaagtgtgagatcgccaggttctacaagctg
cacgagcggaggtgtgagcccattgccatgacagtgcctcgaaagtcggacctgttccag
gaggacctgtacccacccaccgcagggcccgaccctgccctcacggctgaggagtggctg
gggggtcgggatgctgggcccctcctcatctccctcaaggatggctacgtacccccaaag
agccgggagctgagggtcaaccggggcctggacaccgggcgcaggagggcagcaccagag
gccagtggcactcccagctcggatgccgtgtctcggctggaggaggagatgcggaagctc
caggccacggtgcaggagctccagaagcgcttggacaggctggaggagacagtccaggcc
aagtag

DBGET integrated database retrieval system