KEGG   Homo sapiens (human): 113Help
Entry
113               CDS       T01001                                 

Gene name
ADCY7, AC7
Definition
adenylate cyclase 7 (EC:4.6.1.1)
Orthology
K08047  
adenylate cyclase 7 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    113 (ADCY7)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    113 (ADCY7)
   04020 Calcium signaling pathway
    113 (ADCY7)
   04024 cAMP signaling pathway
    113 (ADCY7)
   04022 cGMP - PKG signaling pathway
    113 (ADCY7)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    113 (ADCY7)
  Cellular commiunity
   04540 Gap junction
    113 (ADCY7)
 Organismal Systems
  Immune system
   04611 Platelet activation
    113 (ADCY7)
   04062 Chemokine signaling pathway
    113 (ADCY7)
  Endocrine system
   04911 Insulin secretion
    113 (ADCY7)
   04912 GnRH signaling pathway
    113 (ADCY7)
   04913 Ovarian Steroidogenesis
    113 (ADCY7)
   04915 Estrogen signaling pathway
    113 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    113 (ADCY7)
   04921 Oxytocin signaling pathway
    113 (ADCY7)
   04918 Thyroid hormone synthesis
    113 (ADCY7)
   04916 Melanogenesis
    113 (ADCY7)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113 (ADCY7)
   04270 Vascular smooth muscle contraction
    113 (ADCY7)
  Digestive system
   04970 Salivary secretion
    113 (ADCY7)
   04971 Gastric acid secretion
    113 (ADCY7)
   04972 Pancreatic secretion
    113 (ADCY7)
   04976 Bile secretion
    113 (ADCY7)
  Nervous system
   04724 Glutamatergic synapse
    113 (ADCY7)
   04727 GABAergic synapse
    113 (ADCY7)
   04725 Cholinergic synapse
    113 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    113 (ADCY7)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    113 (ADCY7)
  Environmental adaptation
   04713 Circadian entrainment
    113 (ADCY7)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    113 (ADCY7)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    113 (ADCY7)
  Infectious diseases
   05166 HTLV-I infection
    113 (ADCY7)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     113 (ADCY7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q12.1
AA seq 1080 aa AA seqDB search
MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPS
RHQAILGMAFLVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVGNETGLLAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTKP
NGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaacgagggcgaggagggccctgaccaagatgcg
ctctacgagaagtaccagctcaccagccagcatgggccgctgctgctcacgctcctgctg
gtggccgccactgcctgcgtggccctcatcatcattgccttcagccagggggacccctcc
agacaccaggccattctgggcatggcgttcctggtgctggcggtgtttgcggccctctct
gtgctgatgtacgtcgagtgtctcctgcggcgctggctcagggccttggcgctgctcacc
tgggcctgcttggtggcgctgggctatgtgctggtgttcgacgcatggacaaaggcggcc
tgtgcgtgggagcaggtgcccttcttcctgttcattgtcttcgtggtgtacacactactg
cccttcagcatgcggggcgctgtcgccgttggggccgtctccactgcctcccacctcctg
gtgctcggttctttgatgggaggcttcacgacacccagtgtccgggtggggctgcagctg
ctggccaacgcagtcatcttcctgtgtgggaacctgacaggcgccttccacaagcaccaa
atgcaggatgcgtcccgggacctcttcacctacactgtgaagtgcatccagatccgccgg
aagctgcgcatcgagaagcgccagcaggagaacctgctgctgtcagtgcttccggcccac
atctccatgggcatgaagctggccatcatcgaacggctcaaggagcatggtgaccgtcgc
tgcatgcctgacaacaacttccacagcctctacgtcaagaggcaccagaatgtcagcatc
ctctatgcggacatcgtgggcttcacgcagctggccagcgactgttctcccaaggagctg
gtggtggtgctgaatgagctctttggcaagttcgaccagatcgccaaggccaacgagtgc
atgcgaatcaagatcctcggcgactgctactactgtgtatcgggcctgcccgtgtcgctg
cctacccacgcccggaactgcgtgaagatggggctggacatgtgccaggccatcaagcag
gtgcgggaggccacgggcgtggacatcaacatgcgtgtgggcatacactcggggaatgtg
ctgtgcggggtcatcgggctgcgcaagtggcagtatgacgtgtggtcccacgacgtgtcc
ctggccaaccggatggaggcagccggagtacccggccgggtgcacatcacggaggccacg
ctaaagcacctggacaaggcgtacgaggtggaggatgggcacgggcagcagcgggacccc
tacctcaaggagatgaacatccgcacctacctggtcatcgacccccggagccagcagcca
cccccgcccagccaacacctccccaggcccaagggggacgcggccctgaagatgcgggcg
tcagtgcgcatgacccggtacctcgagtcctggggggcggcacggccctttgcacatctc
aaccaccgtgagagcgtgagcagtggtgagacccacgtccccaacgggcggaggcctaag
agcgttccccagcgccaccgccggaccccagacagaagcatgtcccccaaggggcggtcg
gaggatgactcgtacgatgacgagatgctgtcagccattgaggggctcagctccacgagg
ccctgctgctccaagtccgatgacttctacacctttgggtccatcttcctggagaagggc
tttgagcgcgagtaccgcctggcacccatcccccgggcccgccacgactttgcctgcgcc
agcctgatcttcgtctgcatcctgctcgtccatgtcctgctcatgcccaggacggcggca
ctgggtgtgtccttcgggctggtggcctgtgtactggggctggtgctgggcctgtgcttt
gccaccaagttctcgaggtgctgcccagctcgggggacgctctgcactatctctgagagg
gtggagacacagcccctgctgaggctgaccctggccgtcctgaccatcggcagcctgctc
actgtggccatcatcaacctgcccctgatgcctttccaagttccagagctgcctgttggc
aatgagacaggcctactggccgcgagcagcaagacaagagccctgtgtgagcccctcccg
tactacacctgcagctgtgtcctgggcttcatcgcctgctcggtcttcctgaggatgagc
ctggagccaaaggttgtgctgctgacagtggccctggtggcctacctggtgctcttcaac
ctctccccatgctggcagtgggactgctgcggccaaggcctgggcaacctcaccaagccc
aacggcaccaccagtggcacccctagctgttcctggaaggacctgaagaccatgaccaat
ttctacctggtcctgttctacatcaccctgcttacactctccagacagattgactattac
tgccgcttggactgcctatggaagaagaagttcaagaaggagcacgaggagtttgagacc
atggagaacgtgaaccgccttcttctggagaacgtcctgccagcccacgtggctgcccac
tttatcggtgacaagttaaacgaggactggtaccatcagtcctatgactgcgtctgtgtc
atgtttgcctccgtgccggacttcaaagtgttctacacagagtgcgatgtcaacaaagaa
gggctggagtgcctacgcctgctcaatgagatcattgccgacttcgacgagctcctactg
aagcccaagttcagcggcgtggagaagatcaagaccatcggcagcacgtacatggcagct
gcagggctcagcgtcgcctcagggcacgagaaccaggagctggagcggcagcatgcccac
attggtgtcatggtggagttcagcatcgccctgatgagtaagctggacggcatcaacagg
cactccttcaactccttccgcctccgcgtcggcataaaccatgggcctgtgattgctgga
gtgattggggcccgaaaacctcagtatgacatctggggaaacactgtcaatgtggccagc
cgaatggaaagcactggagaacttgggaaaatccaggttaccgaggagacctgcaccatc
ctccagggcctcgggtactcttgtgaatgccgtggcctgatcaacgtcaaaggcaaaggc
gagctgaggacttactttgtctgtacggacactgccaagtttcaggggctggggctgaac
tga

DBGET integrated database retrieval system