KEGG   Homo sapiens (human): 1131Help
Entry
1131              CDS       T01001                                 

Gene name
CHRM3, EGBRS, HM3, PBS
Definition
(RefSeq) cholinergic receptor muscarinic 3
  KO
K04131  
muscarinic acetylcholine receptor M3
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Taste transduction
Regulation of actin cytoskeleton
Insulin secretion
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Drug target
Oxyphencyclimine [DG:DG00029]: 
Camylofin: 
Mebeverine [DG:DG00030]: 
Trimebutine [DG:DG00031]: 
Dihexyverine [DG:DG00033]: 
Piperidolate [DG:DG00034]: 
Glycopyrronium: 
Propantheline [DG:DG00035]: 
Methantheline [DG:DG00036]: 
Tridihexethyl [DG:DG00037]: 
Isopropamide [DG:DG00038]: 
Hexocyclium [DG:DG00039]: 
Mepenzolate [DG:DG00040]: 
Tiemonium iodide: 
Prifinium bromide: 
Timepidium bromide [DG:DG00041]: 
Valethamate: 
Atropine [DG:DG00052]: 
Hyoscyamine [DG:DG00053]: 
Butylscopolamine: 
Methylatropine [DG:DG01242]: 
Methylscopolamine: 
Fentonium: 
Cimetropium bromide: 
Scopolamine [DG:DG00065]: 
Oxybutynin [DG:DG00478]: 
Propiverine [DG:DG00479]: 
Tolterodine [DG:DG00480]: 
Solifenacin [DG:DG00481]: 
Trospium: 
Darifenacin [DG:DG00482]: 
Fesoterodine [DG:DG00483]: 
Orphenadrine (citrate): 
Trihexyphenidyl [DG:DG00851]: 
Biperiden [DG:DG00852]: 
Metixene [DG:DG00853]: 
Procyclidine [DG:DG00854]: 
Profenamine [DG:DG00855]: 
Dexetimide [DG:DG00856]: 
Mazaticol [DG:DG00857]: 
Orphenadrine (chloride): 
Benzatropine [DG:DG00859]: 
Etybenzatropine: 
Chlorpromazine [DG:DG00867]: 
Carbachol: 
Bethanechol [DG:DG00991]: 
Pilocarpine [DG:DG00992]: 
Choline alfoscerate: 
Cevimeline [DG:DG00993]: 
Ipratropium bromide: 
Oxitropium bromide: 
Tiotropium bromide: 
Aclidinium bromide: 
Umeclidinium bromide: 
Acetylcholine [DG:DG01133]: 
Cyclopentolate [DG:DG01141]: 
Homatropine [DG:DG01142]: 
Tropicamide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    1131 (CHRM3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1131 (CHRM3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1131 (CHRM3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    1131 (CHRM3)
  Digestive system
   04970 Salivary secretion
    1131 (CHRM3)
   04971 Gastric acid secretion
    1131 (CHRM3)
   04972 Pancreatic secretion
    1131 (CHRM3)
  Nervous system
   04725 Cholinergic synapse
    1131 (CHRM3)
  Sensory system
   04742 Taste transduction
    1131 (CHRM3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    1131 (CHRM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 590 aa AA seqDB search
MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPL
GGHTVWQVVFIAFLTGILALVTIIGNILVIVSFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLAIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSM
KRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSF
PKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKR
MSLVKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTFWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKKKRRKQQYQQRQSVIFHKRAPEQAL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcacaataacagtacaacctcgcctttgtttccaaacatcagctcctcctgg
atacacagcccctccgatgcagggctgcccccgggaaccgtcactcatttcggcagctac
aatgtttctcgagcagctggcaatttctcctctccagacggtaccaccgatgaccctctg
ggaggtcataccgtctggcaagtggtcttcatcgctttcttaacgggcatcctggccttg
gtgaccatcatcggcaacatcctggtaattgtgtcatttaaggtcaacaagcagctgaag
acggtcaacaactacttcctcttaagcctggcctgtgccgatctgattatcggggtcatt
tcaatgaatctgtttacgacctacatcatcatgaatcgatgggccttagggaacttggcc
tgtgacctctggcttgccattgactacgtagccagcaatgcctctgttatgaatcttctg
gtcatcagctttgacagatacttttccatcacgaggccgctcacgtaccgagccaaacga
acaacaaagagagccggtgtgatgatcggtctggcttgggtcatctcctttgtcctttgg
gctcctgccatcttgttctggcaatactttgttggaaagagaactgtgcctccgggagag
tgcttcattcagttcctcagtgagcccaccattacttttggcacagccatcgctgctttt
tatatgcctgtcaccattatgactattttatactggaggatctataaggaaactgaaaag
cgtaccaaagagcttgctggcctgcaagcctctgggacagaggcagagacagaaaacttt
gtccaccccacgggcagttctcgaagctgcagcagttacgaacttcaacagcaaagcatg
aaacgctccaacaggaggaagtatggccgctgccacttctggttcacaaccaagagctgg
aaacccagctccgagcagatggaccaagaccacagcagcagtgacagttggaacaacaat
gatgctgctgcctccctggagaactccgcctcctccgacgaggaggacattggctccgag
acgagagccatctactccatcgtgctcaagcttccgggtcacagcaccatcctcaactcc
accaagttaccctcatcggacaacctgcaggtgcctgaggaggagctggggatggtggac
ttggagaggaaagccgacaagctgcaggcccagaagagcgtggacgatggaggcagtttt
ccaaaaagcttctccaagcttcccatccagctagagtcagccgtggacacagctaagact
tctgacgtcaactcctcagtgggtaagagcacggccactctacctctgtccttcaaggaa
gccactctggccaagaggtttgctctgaagaccagaagtcagatcactaagcggaaaagg
atgtccctggtcaaggagaagaaagcggcccagaccctcagtgcgatcttgcttgccttc
atcatcacttggaccccatacaacatcatggttctggtgaacaccttttgtgacagctgc
atacccaaaaccttttggaatctgggctactggctgtgctacatcaacagcaccgtgaac
cccgtgtgctatgctctgtgcaacaaaacattcagaaccactttcaagatgctgctgctg
tgccagtgtgacaaaaaaaagaggcgcaagcagcagtaccagcagagacagtcggtcatt
tttcacaagcgcgcacccgagcaggccttgtag

DBGET integrated database retrieval system