KEGG   Homo sapiens (human): 114Help
Entry
114               CDS       T01001                                 

Gene name
ADCY8, AC8, ADCY3, HBAC1
Definition
adenylate cyclase 8 (brain) (EC:4.6.1.1)
Orthology
K08048  
adenylate cyclase 8 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    114 (ADCY8)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    114 (ADCY8)
   04020 Calcium signaling pathway
    114 (ADCY8)
   04024 cAMP signaling pathway
    114 (ADCY8)
   04022 cGMP - PKG signaling pathway
    114 (ADCY8)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    114 (ADCY8)
  Cellular commiunity
   04540 Gap junction
    114 (ADCY8)
 Organismal Systems
  Immune system
   04611 Platelet activation
    114 (ADCY8)
   04062 Chemokine signaling pathway
    114 (ADCY8)
  Endocrine system
   04911 Insulin secretion
    114 (ADCY8)
   04912 GnRH signaling pathway
    114 (ADCY8)
   04913 Ovarian Steroidogenesis
    114 (ADCY8)
   04915 Estrogen signaling pathway
    114 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    114 (ADCY8)
   04921 Oxytocin signaling pathway
    114 (ADCY8)
   04918 Thyroid hormone synthesis
    114 (ADCY8)
   04916 Melanogenesis
    114 (ADCY8)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    114 (ADCY8)
   04270 Vascular smooth muscle contraction
    114 (ADCY8)
  Digestive system
   04970 Salivary secretion
    114 (ADCY8)
   04971 Gastric acid secretion
    114 (ADCY8)
   04972 Pancreatic secretion
    114 (ADCY8)
   04976 Bile secretion
    114 (ADCY8)
  Nervous system
   04724 Glutamatergic synapse
    114 (ADCY8)
   04727 GABAergic synapse
    114 (ADCY8)
   04725 Cholinergic synapse
    114 (ADCY8)
   04720 Long-term potentiation
    114 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    114 (ADCY8)
  Sensory system
   04742 Taste transduction
    114 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    114 (ADCY8)
  Environmental adaptation
   04713 Circadian entrainment
    114 (ADCY8)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    114 (ADCY8)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    114 (ADCY8)
  Infectious diseases
   05166 HTLV-I infection
    114 (ADCY8)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     114 (ADCY8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24
AA seq 1251 aa AA seqDB search
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEV
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP
NT seq 3756 nt NT seq  +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcaggagcgcctcccggccgcagcggctgctgtggcagacg
gcggtgcgacacatcacggagcagcgcttcattcacgggcaccggggaggcagcggcagc
gggagtggaggctcgggcaaagcctcggaccctgcgggcggcggccccaaccaccacgcg
ccgcagctgtcaggcgactcggcgctgcccctctactcgctgggcccgggagagcgagcg
cacagcacctgcggcaccaaagtcttcccggaacgcagcgggagcggcagtgccagcggc
agcggaggcgggggcgacctgggcttcctgcaccttgactgtgcccctagcaactcggat
ttctttcttaatgggggctatagctaccgaggggtcattttccccaccctgcgcaactcc
ttcaaatctcgggatttggaacgcctctaccagcgctatttcttgggccaaaggcgcaaa
tcggaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctacac
ttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacc
ggcattgaggtagtgatctgcgccctggtggtggtcaggaaggacaccacctcccacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcctggcagca
ggcctcggctacgggctcctgggcgacggcataggctacgtgctcttcacgctcttcgcc
acctacagtatgctgccgctgccgctcacctgggccatcctggccggcctgggcacctcg
ctgctgcaggtcatcctccaagtggtcataccccggctggcggtcatttccatcaaccag
gttgtggcccaggcagtgctattcatgtgtatgaacacagctggaatcttcatcagttac
ctgtcagaccgggcccagcgccaagctttcctggagactcggaggtgtgtggaggccagg
ctgcgcctggagacagagaaccaaagacaggagcggctcgtgctttctgtgctcccccgg
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagatgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatc
ctgggggactgctactactgcgtgtctggacttcctgagccccgccaggaccatgcccac
tgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaaggaca
aaacacgatgttgacatgaggattggaatccactccggctcggtgctgtgcggtgttttg
ggactaaggaagtggcagtttgatgtctggtcttgggatgtggatattgcaaacaaactc
gaatctggaggaatccctgggaggattcacatttccaaagccacgctggactgtctcaac
ggtgactataacgtggaagagggccatggtaaagagaggaatgaattcctgaggaagcat
aatatcgaaacttacttaattaagcagcctgaggacagtctgctgtccttgcctgaagat
atcgtcaaggagtcagtgagctcctcagaccggagaaacagtggggccacattcactgaa
ggatcctggagccctgaactgccctttgataatatcgtggggaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcattt
atcgttcttctatttatcacggcaatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcactcggctctggtcctcatcaccaca
gcagaggattataaatgtttgcccctcatcctccggaaaacttgctgttggattaatgag
acctatttggcccggaacgtcatcatctttgcatccattttgattaatttcctgggtgcc
atcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacgggg
gtgttggccatggtgacctgtgcagttttcctccggctgaactccgtcctgaagctggca
gtgctgctgatcatgattgccatctatgccctgctcactgagaccgtctacgcaggcctc
tttctgcgttatgacaacctcaaccacagtggagaagatttcctggggaccaaggaggta
tcactgctactgatggccatgttcctcctggctgtgttctaccatggacagcagctggag
tacacagcccgcctggacttcctttggcgagtacaggccaaagaggagatcaatgagatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccatgtggcc
cgccatttcctagagaaggaccgagacaatgaggagctgtattctcaatcctatgatgct
gttggggtgatgtttgcctccatcccaggatttgcggacttttactctcagactgaaatg
aataaccagggagtggaatgcctgcgcttgctcaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggcagcacctac
atggccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacatttg
tgtgctctggctgacttctcactcgccctgacagaaagcatacaggagatcaacaagcat
tcattcaacaattttgaactccggattggcatcagccacggctcagtggtagctggcgtt
atcggcgctaagaaaccacagtatgacatttggggcaaaactgtgaacctggcaagccga
atggacagcacgggggttagtggccggatccaagtcccagaggagacctatctcatcctg
aaggaccagggctttgcctttgattaccgaggggagatctatgtgaagggtatcagtgaa
caggaaggaaaaatcaaaacgtactttcttctgggaagagtccaacccaacccattcatc
ttgcccccaagaagactgcctgggcagtactccctggccgcggttgtcctgggacttgtc
cagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacaggaatc
atcaagggtcattacaaccggcggactttgttgtcacccagcggcacagagcctggagcc
caggctgaaggcaccgacaaatctgatttgccataa

DBGET integrated database retrieval system