KEGG   Homo sapiens (human): 114609Help
Entry
114609            CDS       T01001                                 

Gene name
TIRAP, BACTS1, Mal, MyD88-2, wyatt
Definition
toll-interleukin 1 receptor (TIR) domain containing adaptor protein
Orthology
K05403  
toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Pertussis
Tuberculosis
Hepatitis B
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Human Diseases; Infectious diseases; Pertussis [PATH:hsa05133]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.2
AA seq 221 aa AA seqDB search
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcgacctccctcccagctcctggctctcggcctaagaagcctctaggcaag
atggctgactggttcaggcagaccctgctgaagaagcccaagaagaggcccaactcccca
gaaagcacctccagcgatgcttcacagcctacctcacaggacagcccactacccccaagc
ctcagctcagtcacgtctcccagcctgccacccacacatgcgagtgacagtggcagtagt
cgctggagcaaagactatgacgtctgcgtgtgccacagtgaggaagacctggtggccgcc
caggacctggtctcctacttggaaggcagcactgccagcctgcgctgcttcctgcaactc
cgggatgcaaccccaggcggcgctatagtgtccgagctgtgccaggcactgagcagtagt
cactgccgggtgctgctcatcacgccgggcttccttcaggacccctggtgcaagtaccag
atgctgcaggccctgaccgaggctccaggggccgagggctgcaccatccccctgctgtcg
ggcctcagcagagctgcctacccacctgagctccgattcatgtactacgtcgatggcagg
ggccctgatggtggctttcgtcaagtcaaagaagctgtcatgcgttatctgcagacactc
agttga

DBGET integrated database retrieval system