KEGG   Homo sapiens (human): 114609Help
Entry
114609            CDS       T01001                                 

Gene name
TIRAP, BACTS1, Mal, MyD88-2, wyatt
Definition
toll-interleukin 1 receptor (TIR) domain containing adaptor protein
Orthology
K05403  
toll-interleukin 1 receptor (TIR) domain-containing adaptor protein
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Pertussis
Tuberculosis
Hepatitis B
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    114609 (TIRAP)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    114609 (TIRAP)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    114609 (TIRAP)
   05152 Tuberculosis
    114609 (TIRAP)
   05161 Hepatitis B
    114609 (TIRAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q24.2
AA seq 221 aa AA seqDB search
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKEAVMRYLQTLS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcgacctccctcccagctcctggctctcggcctaagaagcctctaggcaag
atggctgactggttcaggcagaccctgctgaagaagcccaagaagaggcccaactcccca
gaaagcacctccagcgatgcttcacagcctacctcacaggacagcccactacccccaagc
ctcagctcagtcacgtctcccagcctgccacccacacatgcgagtgacagtggcagtagt
cgctggagcaaagactatgacgtctgcgtgtgccacagtgaggaagacctggtggccgcc
caggacctggtctcctacttggaaggcagcactgccagcctgcgctgcttcctgcaactc
cgggatgcaaccccaggcggcgctatagtgtccgagctgtgccaggcactgagcagtagt
cactgccgggtgctgctcatcacgccgggcttccttcaggacccctggtgcaagtaccag
atgctgcaggccctgaccgaggctccaggggccgagggctgcaccatccccctgctgtcg
ggcctcagcagagctgcctacccacctgagctccgattcatgtactacgtcgatggcagg
ggccctgatggtggctttcgtcaagtcaaagaagctgtcatgcgttatctgcagacactc
agttga

DBGET integrated database retrieval system