KEGG   Homo sapiens (human): 1147Help
Entry
1147              CDS       T01001                                 

Gene name
CHUK, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04068  FoxO signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00686  Toll-like receptor signaling
Network
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00201  KSHV vFLIP to host-cell-protein activation
Disease
H00882  Cocoon syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1147 (CHUK)
   04010 MAPK signaling pathway
    1147 (CHUK)
   04064 NF-kappa B signaling pathway
    1147 (CHUK)
   04668 TNF signaling pathway
    1147 (CHUK)
   04068 FoxO signaling pathway
    1147 (CHUK)
   04151 PI3K-Akt signaling pathway
    1147 (CHUK)
   04150 mTOR signaling pathway
    1147 (CHUK)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1147 (CHUK)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    1147 (CHUK)
   04621 NOD-like receptor signaling pathway
    1147 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    1147 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    1147 (CHUK)
   04625 C-type lectin receptor signaling pathway
    1147 (CHUK)
   04660 T cell receptor signaling pathway
    1147 (CHUK)
   04658 Th1 and Th2 cell differentiation
    1147 (CHUK)
   04659 Th17 cell differentiation
    1147 (CHUK)
   04657 IL-17 signaling pathway
    1147 (CHUK)
   04662 B cell receptor signaling pathway
    1147 (CHUK)
   04062 Chemokine signaling pathway
    1147 (CHUK)
  Endocrine system
   04920 Adipocytokine signaling pathway
    1147 (CHUK)
  Development
   04380 Osteoclast differentiation
    1147 (CHUK)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1147 (CHUK)
   05212 Pancreatic cancer
    1147 (CHUK)
   05221 Acute myeloid leukemia
    1147 (CHUK)
   05220 Chronic myeloid leukemia
    1147 (CHUK)
   05215 Prostate cancer
    1147 (CHUK)
   05222 Small cell lung cancer
    1147 (CHUK)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    1147 (CHUK)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1147 (CHUK)
   05131 Shigellosis
    1147 (CHUK)
   05166 HTLV-I infection
    1147 (CHUK)
   05162 Measles
    1147 (CHUK)
   05161 Hepatitis B
    1147 (CHUK)
   05160 Hepatitis C
    1147 (CHUK)
   05168 Herpes simplex infection
    1147 (CHUK)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1147 (CHUK)
   05169 Epstein-Barr virus infection
    1147 (CHUK)
   05165 Human papillomavirus infection
    1147 (CHUK)
   05145 Toxoplasmosis
    1147 (CHUK)
   05142 Chagas disease (American trypanosomiasis)
    1147 (CHUK)
  Drug resistance
   01523 Antifolate resistance
    1147 (CHUK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     1147 (CHUK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   1147 (CHUK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr IKKbetaNEMObind Kdo AviRa
Motif
Other DBs
NCBI-GeneID: 1147
NCBI-ProteinID: NP_001269
OMIM: 600664
HGNC: 1974
Ensembl: ENSG00000213341
Vega: OTTHUMG00000018899
Pharos: O15111(Tchem)
UniProt: O15111
Structure
PDB: 

Jmol
Position
10q24.31
AA seq 745 aa AA seqDB search
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatggtgccat
gaaatccagattatgaagaagttgaaccatgccaatgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttagtagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtattaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtatatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tatagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaatatcaaagaagctgacaatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacatca
gcatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
caagatggggagacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcaatagtatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system