KEGG   Homo sapiens (human): 1147Help
Entry
1147              CDS       T01001                                 

Gene name
CHUK, IKBKA, IKK-alpha, IKK1, IKKA, NFKBIKA, TCF16
Definition
conserved helix-loop-helix ubiquitous kinase (EC:2.7.11.10)
Orthology
K04467  
inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Chemokine signaling pathway
NF-kappa B signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Osteoclast differentiation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Epithelial cell signaling in Helicobacter pylori infection
Shigellosis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Hepatitis C
Hepatitis B
Measles
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Pancreatic cancer
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Disease
H00882  
Cocoon syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    1147 (CHUK)
   04010 MAPK signaling pathway
    1147 (CHUK)
   04064 NF-kappa B signaling pathway
    1147 (CHUK)
   04668 TNF signaling pathway
    1147 (CHUK)
   04068 FoxO signaling pathway
    1147 (CHUK)
   04151 PI3K-Akt signaling pathway
    1147 (CHUK)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    1147 (CHUK)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    1147 (CHUK)
   04621 NOD-like receptor signaling pathway
    1147 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    1147 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    1147 (CHUK)
   04660 T cell receptor signaling pathway
    1147 (CHUK)
   04662 B cell receptor signaling pathway
    1147 (CHUK)
   04062 Chemokine signaling pathway
    1147 (CHUK)
  Endocrine system
   04920 Adipocytokine signaling pathway
    1147 (CHUK)
  Development
   04380 Osteoclast differentiation
    1147 (CHUK)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1147 (CHUK)
   05212 Pancreatic cancer
    1147 (CHUK)
   05221 Acute myeloid leukemia
    1147 (CHUK)
   05220 Chronic myeloid leukemia
    1147 (CHUK)
   05215 Prostate cancer
    1147 (CHUK)
   05222 Small cell lung cancer
    1147 (CHUK)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    1147 (CHUK)
   05131 Shigellosis
    1147 (CHUK)
   05166 HTLV-I infection
    1147 (CHUK)
   05162 Measles
    1147 (CHUK)
   05161 Hepatitis B
    1147 (CHUK)
   05160 Hepatitis C
    1147 (CHUK)
   05168 Herpes simplex infection
    1147 (CHUK)
   05169 Epstein-Barr virus infection
    1147 (CHUK)
   05145 Toxoplasmosis
    1147 (CHUK)
   05142 Chagas disease (American trypanosomiasis)
    1147 (CHUK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     1147 (CHUK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  IKK family [Table]
   1147 (CHUK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24-q25
AA seq 745 aa AA seqDB search
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGNSMMNLDWSWLTE
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatggtgccat
gaaatccagattatgaagaagttgaaccatgccaatgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttagtagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacctgttgaccttactttgaagcagccaagatgt
tttgtattaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtatatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tatagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatacctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaatatcaaagaagctgacaatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacatca
gcatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
caagatggggagacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcaatagtatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system