KEGG   Homo sapiens (human): 115Help
Entry
115               CDS       T01001                                 

Gene name
ADCY9, AC9
Definition
adenylate cyclase 9 (EC:4.6.1.1)
Orthology
K08049  
adenylate cyclase 9 [EC:4.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
Vibrio cholerae infection
HTLV-I infection
Dilated cardiomyopathy
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    115 (ADCY9)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    115 (ADCY9)
   04020 Calcium signaling pathway
    115 (ADCY9)
   04022 cGMP - PKG signaling pathway
    115 (ADCY9)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    115 (ADCY9)
  Cell communication
   04540 Gap junction
    115 (ADCY9)
 Organismal Systems
  Immune system
   04611 Platelet activation
    115 (ADCY9)
   04062 Chemokine signaling pathway
    115 (ADCY9)
  Endocrine system
   04911 Insulin secretion
    115 (ADCY9)
   04912 GnRH signaling pathway
    115 (ADCY9)
   04913 Ovarian Steroidogenesis
    115 (ADCY9)
   04915 Estrogen signaling pathway
    115 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    115 (ADCY9)
   04921 Oxytocin signaling pathway
    115 (ADCY9)
   04918 Thyroid hormone synthesis
    115 (ADCY9)
   04916 Melanogenesis
    115 (ADCY9)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    115 (ADCY9)
   04270 Vascular smooth muscle contraction
    115 (ADCY9)
  Digestive system
   04970 Salivary secretion
    115 (ADCY9)
   04971 Gastric acid secretion
    115 (ADCY9)
   04972 Pancreatic secretion
    115 (ADCY9)
   04976 Bile secretion
    115 (ADCY9)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    115 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    115 (ADCY9)
  Nervous system
   04724 Glutamatergic synapse
    115 (ADCY9)
   04727 GABAergic synapse
    115 (ADCY9)
   04725 Cholinergic synapse
    115 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    115 (ADCY9)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    115 (ADCY9)
  Environmental adaptation
   04713 Circadian entrainment
    115 (ADCY9)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    115 (ADCY9)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    115 (ADCY9)
  Infectious diseases
   05110 Vibrio cholerae infection
    115 (ADCY9)
   05166 HTLV-I infection
    115 (ADCY9)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     115 (ADCY9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 1353 aa AA seqDB search
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRGLLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSER
NPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEE
RGRFGKAIEKDDCDETGIEEANELTKLNVSKSV
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccaccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaaatacagcatctcctctagctgcagcagctctggggactcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgcgctgtgcttcctcctggtgtgtgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacggccacagcccggcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctctataccgtcatgcactta
cctttgtacctgagtttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgctgagcagggggctgctccacggctgcatccacgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggtggggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagaggatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggagatgaggagagtgagaattctgtcaagagg
catgccacctcgagccccaagaacaggaagaaaaagtcttccatccaaaaagctcctata
gccttccgcccttttaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtctgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaaaatcagcacc
ctgggagactgttactactgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgagagtcggggtgcacacgggcaccgtcctttgcggcatcctg
ggcatgaggaggtttaaatttgacgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccaccgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttattgaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacatttgctcccaaa
tctgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggcttctggaggacctaatcccaaaactcagaacgggctcctcagccctccc
caagaggagaagctcaccaacagtcagacttctctgtgtgagatcttgcaggagaaggga
aggtgggcaggggtgagcctggaccagtcggctctccttccgctgaggttcaagaacatc
cgggagaaaacggacgcccactttgtggacgttatcaaagaagacagcctgatgaaagat
tacttttttaagccgcccattaatcagttcagcctgaacttcctggatcaggagctggag
cgatcctacaggaccagctatcaggaagaggtcataaagaactcccccgtgaagacgttt
gctagtcccaccttcagctccctcctggatgtgtttctgtcgaccacagtgtttctgacg
ctgtccaccacctgcttcctgaagtacgaggcggccaccgtgcctcccccgcccgccgcc
ctggcggtcttcagtgcagccctgctgctggaggtgctgtccctcgcggtgtccatcagg
atggtgttcttcctggaggacgtcatggcctgcaccaagcgcctgctggagtggatcgcc
ggctggctaccacgtcactgcatcggggccatcctggtgtcgcttcccgcactggccgtc
tactcccatgtcacctccgaatatgagaccaacatacacttcccagtgttcacaggctcg
gccgcgctgattgccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccctcgccaccgtcgtgggggccgggccgctgctcctgctctacgtctccctgtgc
ccagacagttctgtattaacttcgccccttgacgcagtacagaatttcagttccgagagg
aacccgtgcaatagttcggtgccgcgtgacctccggcggcccgccagcctcatcggccag
gaggtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaattt
gaagtcagctaccgcctccactaccacggagacgtggaagcggatcttcaccgcaccaag
atccagagcatgcgggaccaggcagactggctgctgaggaacatcatcccctaccacgtg
gctgagcagctgaaggtgtcccagacctactccaagaaccatgacagcggaggggtgatc
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctcatcggggactttgacgagctcctaagcaagccggac
tacagcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcagggctg
aacaccgcgcaggcccaggacggcagccacccgcaggagcacctgcagatcctgttcgag
ttcgccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaac
ttcaagctccgcgtcggcttcaaccatgggcccctcacggccggggtcatcggcaccacc
aagctgctgtacgacatctggggagacaccgtcaacatcgccagcaggatggacaccacc
ggcgtggagtgccgcatccaggtgagcgaagagagctaccgcgtcttgagcaagatgggc
tatgacttcgactacagagggaccgtgaatgtcaaggggaaaggccagatgaagacctac
ctgtacccaaagtgcacggatcacagggtcatcccacagcaccagctgtccatctcccca
gacatccgcgtccaggtggatggcagcatcggacggtctcccacagacgagattgccaac
ctggtgccttctgtccagtatgtggacaagacatctctgggttctgacagcagcacgcag
gccaaggatgcccacctgtcccccaagagaccgtggaaggagcccgtcaaagccgaagaa
aggggtcgatttggcaaagccatagagaaagacgactgtgacgaaacaggaatagaagaa
gccaacgaactcaccaagctcaacgtttcaaagagtgtgtga

DBGET integrated database retrieval system