KEGG   Homo sapiens (human): 1152Help
Entry
1152              CDS       T01001                                 

Gene name
CKB, B-CK, BCK, CKBB, HEL-S-29
Definition
creatine kinase, brain (EC:2.7.3.2)
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32
AA seq 381 aa AA seqDB search
MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcccttctccaacagccacaacgcactgaagctgcgcttcccggccgaggacgagttc
cccgacctgagcgcccacaacaaccacatggccaaggtgctgacccccgagctgtacgcg
gagctgcgcgccaagagcacgccgagcggcttcacgctggacgacgtcatccagacaggc
gtggacaacccgggccacccgtacatcatgaccgtgggctgcgtggcgggcgacgaggag
tcctacgaagtgttcaaggatctcttcgaccccatcatcgaggaccggcacggcggctac
aagcccagcgatgagcacaagaccgacctcaaccccgacaacctgcagggcggcgacgac
ctggaccccaactacgtgctgagctcgcgggtgcgcacgggccgcagcatccgtggcttc
tgcctccccccgcactgcagccgcggggagcgccgcgccatcgagaagctcgcggtggaa
gccctgtccagcctggacggcgacctggcgggccgatactacgcgctcaagagcatgacg
gaggcggagcagcagcagctcatcgacgaccacttcctcttcgacaagcccgtgtcgccc
ctgctgctggcctcgggcatggcccgcgactggcccgacgcccgcggtatctggcacaat
gacaataagaccttcctggtgtgggtcaacgaggaggaccacctgcgggtcatctccatg
cagaaggggggcaacatgaaggaggtgttcacccgcttctgcaccggcctcacccagatt
gaaactctcttcaagtctaaggactatgagttcatgtggaaccctcacctgggctacatc
ctcacctgcccatccaacctgggcaccgggctgcgggcaggtgtgcatatcaagctgccc
aacctgggcaagcatgagaagttctcggaggtgcttaagcggctgcgacttcagaagcga
ggcacaggcggtgtggacacggctgcggtgggcggggtcttcgacgtctccaacgctgac
cgcctgggcttctcagaggtggagctggtgcagatggtggtggacggagtgaagctgctc
atcgagatggagcagcggctggagcagggccaggccatcgacgacctcatgcctgcccag
aaatga

DBGET integrated database retrieval system