KEGG   Homo sapiens (human): 116984Help
Entry
116984            CDS       T01001                                 

Gene name
ARAP2, CENTD1, PARX
Definition
ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
Orthology
K12490  
Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Endocytosis
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p14
AA seq 1704 aa AA seqDB search
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQL
ETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIES
LITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS
PPSPFFKFQGEMIVNDLYVPSSPILAPVRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGVS
GSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQGE
ALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE
CFQSLRRKNSKASKSRTQKALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGAS
AKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLY
QAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKED
FYLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQ
LFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGI
LKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSMKFYRGVKKKMKP
PTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEYDIWPPAGKERKRSITKNPKIG
GLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERASMVAHCLEHKD
DKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVI
EELNVVLQRSRTLPKELQDEQILK
NT seq 5115 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagtcagtgaagtaaatgtggatataaaagatttcctaatgagcattaatttg
gagcagtatctcttacatttccatgagtctggttttactactgtgaaggactgtgcagca
ataaatgacagcctgctgcagaaaattggaatatcacctacaggtcaccgtaggaggata
cttaaacagttacagataatcttgtcaaaaatgcaagatattccaatatatgcaaatgtt
cataaaactaagaagaatgatgacccttcaaaggattaccatgttccatcttctgatcag
aatatctgcatagaactttccaattctggtagtgttcagacatctagcccaccgcagttg
gagactgttagaaaaaatcttgaagacagtgatgcaagtgtggaaagaagccagtatcct
caatcagatgataagctgtctcctcctaaacgcgacttccccactgcagaggaaccacac
ctgaatttgggttctttgaatgattctttatttggtagtgacaatattaaaatagaatca
ttgattacaaagaagactgtggatcacacagttgaagaacaacaaacagaaaaagttaaa
ttgatcacagaaaatctcagtaagctccctaatgcagactctgaatgcctttcttttgtt
ggctgttcaacatcaggaacaaattctggaaatggaacaaatggtttattagaaggatca
ccaccatccccattctttaagtttcaaggagaaatgattgtaaatgacttgtatgttcca
tcatcaccaatcctagcacctgtgagaagtcgtagcaagttggtttcaagaccatctcga
tcttttctgctaagacatcgacctgtaccagagattccagggtcaacaaaaggagtttct
gggagctatttccgtgaaagaagaaatgttgctacctcaactgaaaaatctgtggcatgg
caaaattcaaatgaggagaattcatcttccatctttccttatggagagacctttctcttc
cagagactagaaaattccaagaagcgatctataaagaatgaatttttgacccagggagaa
gcactcaaaggggaagcagctactgcaacaaactcttttatcatcaaatcaagcatatac
gataacagaaaggagaaaataagcgaggacaaggtggaagatatttggatacctcgagag
gacaaaaacaattttttgatagacactgcttctgaatcagaatactcaacagtagaagaa
tgctttcagagtttaagaagaaaaaattcaaaggcatctaaatctaggactcaaaaagcc
ttgattttggactccgttaataggcacagttatccgttaagctcaacaagtggaaatgct
gattcatcagccgtttcttcacaggcaatatctccctatgcctgcttttatggagcatct
gcaaagaaggttaaatcaggatggctggataaactctctcctcaaggaaaacgcatgttt
caaaagagatgggtgaaatttgatggccttagcatttcttactacaataatgagaaggag
atgtattcgaaaggaataattcccctttctgctatatcaacagtacgagttcaaggagac
aacaaatttgaagttgttacaacacaaagaacttttgtttttagagtagaaaaagaagag
gagagaaatgactggatcagcatactattaaatgcactgaaatcacaatcccttacctcg
cagtctcaagctgttgttacacctgagaaatgtggatatcttgaattgagaggctataag
gcaaaaatttttactgtgttaagtggaaacagtgtgtggctttgcaaaaacgaacaggat
tttaagagtggacttggtattaccataattcctatgaatgtagcaaatgtaaagcaagtg
gaccgaactgtgaaacaatcttttgaaataatcactccctacaggagtttcagctttaca
gccgagactgaaaaggagaaacaagactggattgaagctgtgcagcaatcaatagcagaa
actctctctgattatgaagtagctgagaagatttggttcaatgaatccaacaggagctgt
gcagattgtaaagccccagatcctgactgggcatccatcaatctctgtgttgtcatctgt
aagaagtgtgcaggacagcatagatctttaggaccaaaagattccaaggttagaagtcta
aaaatggatgctagcatttggagcaatgaactcatcgagctttttattgtcattggaaac
aaaagagcaaatgacttttgggctggtaatcttcaaaaggatgaagaattacatatggac
tcaccagtagaaaagagaaaaaactttattactcagaaatataaagaaggaaaattcaga
aaaactcttttggcatctctcaccaaagaagaattaaataaggctctatgtgctgctgta
gtgaaaccggatgttctagaaacaatggctttgctgttcagtggagcagatgtcatgtgt
gccaccggagaccccgtgcatagcaccccctatctgctagccaagaaagctgggcaaagt
ctgcaaatggaatttctctaccataacaaattctcagatttccctcaacatgatattcat
tccgagggtgtattaagtcaagagtcttcccagtccacattcctctgtgactttttatat
caagctccttctgctgcttctaaactctcttcagagaaaaaactgcttgaagagacaaat
aaaaaatggtgtgttttggaaggaggcttcttgagttactatgaaaatgataagtctacc
acacctaatggcaccattaatatcaatgaagttatctgcctggctatacacaaagaggac
ttctatttaaatactgggcccatctttatctttgagatctacttaccctccgaacgtgtg
tttttatttggagctgaaacatctcaagctcaaagaaaatggacagaggcaatagccaag
cattttgttcccttatttgctgaaaacttaacagaagctgactatgatttgattggtcaa
ctcttctacaaagactgccatgccctggatcagtggagaaaaggctggtttgctatggac
aaatccagcttgcatttttgccttcaaatgcaagaagttcagggagatagaatgcactta
agaagactgcaagagctaacaatcagcacaatggttcaaaatggggaaaaactggatgtt
ttactcttggtagaaaaagggagaacattatacatccatgggcataccaagttggatttc
acagtctggcatactgcaattgaaaaagcagcaggtacagatggtaatgctttacaagat
cagcagctcagcaaaaatgacgttcccattatagtgaacagctgtatagcatttgttaca
cagtatggtttaggatgcaaatatatctatcaaaagaatggtgatcctttgcatataagt
gaactcctggagagtttcaaaaaggatgcaagaagctttaaattgagggctggaaaacat
cagcttgaagatgtgacggctgtgttgaaaagttttctctctgacattgatgatgcactg
cttactaaggagctctacccatattggatctctgctttagatacgcaagatgacaaggaa
agaattaaaaaatatggagcatttatacgttctcttccaggggtcaaccgagcaacacta
gcagctatcattgaacacctgtatagggttcagaaatgctcagaaatcaatcacatgaat
gcccataatttggccttggtcttttcatcctgtttgtttcaaacgaagggacaaactagt
gaagaagtgaatgtaattgaggacctaattaataattatgtagaaatatttgaggttaaa
gaagatcaagtcaaacaaatggacatagaaaatagctttattaccaagtggaaagacacc
caagtttcccaggctggagatttgttaattgaagtatatgtagaaaggaaggaacccgac
tgtagtattataattcggatatctcctgtgatggaagcagaagaattaactaatgatata
ttagcgataaaaaatattattcctacaaaaggtgatatttgggccacatttgaagtcatt
gaaaatgaagagctagagcgtcctcttcactacaaggaaaatgtactggagcaggtgctt
cggtggagttcattagctgaacctggctctgcttacctggtggtgaagagattcttaacc
gctgacacaattaaacactgcagtgaccggagtacactgggaagcatcaaagaaggaatc
ttgaaaatcaaagaagaaccatccaaaatactatctggaaataagtttcaagaccggtat
tttgttttacgagatgggtttctctttctttacaaggatgtgaagagtagtaaacatgac
aagatgttttctctcagttccatgaagttttatcgtggagtgaaaaagaaaatgaagcct
ccaacaagctggggattgaccgcatattctgagaaacatcactggcacctgtgttgtgat
agttcacgaactcagacggagtggatgaccagtatctttattgcccagcatgaatatgat
atatggccaccagctggaaaggaacgaaaacgttcaataaccaaaaatcccaaaattgga
ggtttgcctctgattcctatacagcatgaggggaatgcaaccttggcccggaaaaatatt
gagagtgcaagagcagaacttgaaaggctgcggctcagtgaaaagtgtgataaagagtcc
gtggactctagcttaaaggagagagcttccatggtggcccactgcctggagcacaaggac
gataaacttcgaaatcgaccccgaaaacatcggagtttcaactgcctggaggacacagag
cctgaagccccacttgggcaaccaaaaggccataaaggcctaaagacattgaggaagact
gaggacaggaatagcaaagctactttggactctgatcataagttaccatcaagggtaatt
gaagaacttaatgtggttctacaacggtcaagaacccttccaaaagaattacaggatgag
cagattttgaagtag

DBGET integrated database retrieval system