KEGG   Homo sapiens (human): 1173Help
Entry
1173              CDS       T01001                                 

Gene name
AP2M1, AP50, CLAPM1, mu2
Definition
(RefSeq) adaptor related protein complex 2 mu 1 subunit
  KO
K11826  AP-2 complex subunit mu-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1173 (AP2M1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1173 (AP2M1)
  Nervous system
   04721 Synaptic vesicle cycle
    1173 (AP2M1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1173 (AP2M1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    1173 (AP2M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s muHD
Motif
Other DBs
NCBI-GeneID: 1173
NCBI-ProteinID: NP_004059
OMIM: 601024
HGNC: 564
Ensembl: ENSG00000161203
Vega: OTTHUMG00000156822
Pharos: Q96CW1(Tbio)
UniProt: Q96CW1
Structure
PDB: 

Jmol
Position
3q27.1
AA seq 435 aa AA seqDB search
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLES
VNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQS
IAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTK
LEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAG
MKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK
WVRYIGRSGIYETRC
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattggaggcttattcatctataatcacaagggggaggtgctcatctcccgagtctac
cgagatgacatcgggaggaacgcagtggatgcctttcgggtcaatgttatccatgcccgg
cagcaggtgcgcagccccgtcaccaacattgctcgcaccagcttcttccacgttaagcgg
tccaacatttggctggcagcagtcaccaagcagaatgtcaacgctgccatggtcttcgaa
ttcctctataagatgtgtgacgtgatggctgcctactttggcaagatcagcgaggaaaac
atcaagaacaattttgtgctcatatatgagctgctggatgagattctagactttggctac
ccacagaattccgagacaggcgcgctgaaaaccttcatcacgcagcagggcatcaagagt
cagcatcagacaaaagaagagcagtcacagatcaccagccaggtaactgggcagattggc
tggcggcgagagggtatcaagtatcgtcggaatgagctcttcctggatgtgctggagagt
gtgaacctgctcatgtccccacaagggcaggtgctgagtgcccatgtgtcgggccgggtg
gtgatgaagagctacctgagtggcatgcctgaatgcaagtttgggatgaatgacaagatt
gttattgaaaagcagggcaaaggcacagctgatgaaacaagcaagagcgggaagcaatca
attgccattgatgactgcaccttccaccagtgtgtgcgactcagcaagtttgactctgaa
cgcagcatcagctttatcccgccagatggagagtttgagcttatgaggtatcgcacaacc
aaggacatcatccttcccttccgggtgatcccgctagtgcgagaagtgggacgcaccaaa
ctggaggtcaaggtggtcatcaagtccaactttaaaccctcactgctggctcagaagatc
gaggtgaggatcccaaccccactgaacacaagcggggtgcaggtgatctgcatgaagggg
aaggccaagtacaaggccagcgagaatgccatcgtgtggaagatcaagcgcatggcaggc
atgaaggaatcgcagatcagcgcagagattgagcttctgcctaccaacgacaagaagaaa
tgggctcgaccccccatttccatgaactttgaggtgccattcgcgccctctggcctcaag
gtgcgctacttgaaggtgtttgaaccgaagctgaactacagcgaccatgatgtcatcaaa
tgggtgcgctacattggccgcagtggcatttatgaaactcgctgctag

DBGET integrated database retrieval system