KEGG   Homo sapiens (human): 1173Help
Entry
1173              CDS       T01001                                 

Gene name
AP2M1, AP50, CLAPM1, mu2
Definition
adaptor-related protein complex 2, mu 1 subunit
Orthology
K11826  
AP-2 complex subunit mu-1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q28
AA seq 433 aa AA seqDB search
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVN
LLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIA
IDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLE
VKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMK
ESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWV
RYIGRSGIYETRC
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattggaggcttattcatctataatcacaagggggaggtgctcatctcccgagtctac
cgagatgacatcgggaggaacgcagtggatgcctttcgggtcaatgttatccatgcccgg
cagcaggtgcgcagccccgtcaccaacattgctcgcaccagcttcttccacgttaagcgg
tccaacatttggctggcagcagtcaccaagcagaatgtcaacgctgccatggtcttcgaa
ttcctctataagatgtgtgacgtgatggctgcctactttggcaagatcagcgaggaaaac
atcaagaacaattttgtgctcatatatgagctgctggatgagattctagactttggctac
ccacagaattccgagacaggcgcgctgaaaaccttcatcacgcagcagggcatcaagagt
cagacaaaagaagagcagtcacagatcaccagccaggtaactgggcagattggctggcgg
cgagagggtatcaagtatcgtcggaatgagctcttcctggatgtgctggagagtgtgaac
ctgctcatgtccccacaagggcaggtgctgagtgcccatgtgtcgggccgggtggtgatg
aagagctacctgagtggcatgcctgaatgcaagtttgggatgaatgacaagattgttatt
gaaaagcagggcaaaggcacagctgatgaaacaagcaagagcgggaagcaatcaattgcc
attgatgactgcaccttccaccagtgtgtgcgactcagcaagtttgactctgaacgcagc
atcagctttatcccgccagatggagagtttgagcttatgaggtatcgcacaaccaaggac
atcatccttcccttccgggtgatcccgctagtgcgagaagtgggacgcaccaaactggag
gtcaaggtggtcatcaagtccaactttaaaccctcactgctggctcagaagatcgaggtg
aggatcccaaccccactgaacacaagcggggtgcaggtgatctgcatgaaggggaaggcc
aagtacaaggccagcgagaatgccatcgtgtggaagatcaagcgcatggcaggcatgaag
gaatcgcagatcagcgcagagattgagcttctgcctaccaacgacaagaagaaatgggct
cgaccccccatttccatgaactttgaggtgccattcgcgccctctggcctcaaggtgcgc
tacttgaaggtgtttgaaccgaagctgaactacagcgaccatgatgtcatcaaatgggtg
cgctacattggccgcagtggcatttatgaaactcgctgctag

DBGET integrated database retrieval system