KEGG   Homo sapiens (human): 1173Help
Entry
1173              CDS       T01001                                 

Gene name
AP2M1, AP50, CLAPM1, mu2
Definition
adaptor-related protein complex 2, mu 1 subunit
Orthology
K11826  
AP-2 complex subunit mu-1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1173 (AP2M1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1173 (AP2M1)
  Nervous system
   04721 Synaptic vesicle cycle
    1173 (AP2M1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1173 (AP2M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q28
AA seq 433 aa AA seqDB search
MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKR
SNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGY
PQNSETGALKTFITQQGIKSQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVN
LLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIA
IDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLE
VKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRMAGMK
ESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWV
RYIGRSGIYETRC
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgattggaggcttattcatctataatcacaagggggaggtgctcatctcccgagtctac
cgagatgacatcgggaggaacgcagtggatgcctttcgggtcaatgttatccatgcccgg
cagcaggtgcgcagccccgtcaccaacattgctcgcaccagcttcttccacgttaagcgg
tccaacatttggctggcagcagtcaccaagcagaatgtcaacgctgccatggtcttcgaa
ttcctctataagatgtgtgacgtgatggctgcctactttggcaagatcagcgaggaaaac
atcaagaacaattttgtgctcatatatgagctgctggatgagattctagactttggctac
ccacagaattccgagacaggcgcgctgaaaaccttcatcacgcagcagggcatcaagagt
cagacaaaagaagagcagtcacagatcaccagccaggtaactgggcagattggctggcgg
cgagagggtatcaagtatcgtcggaatgagctcttcctggatgtgctggagagtgtgaac
ctgctcatgtccccacaagggcaggtgctgagtgcccatgtgtcgggccgggtggtgatg
aagagctacctgagtggcatgcctgaatgcaagtttgggatgaatgacaagattgttatt
gaaaagcagggcaaaggcacagctgatgaaacaagcaagagcgggaagcaatcaattgcc
attgatgactgcaccttccaccagtgtgtgcgactcagcaagtttgactctgaacgcagc
atcagctttatcccgccagatggagagtttgagcttatgaggtatcgcacaaccaaggac
atcatccttcccttccgggtgatcccgctagtgcgagaagtgggacgcaccaaactggag
gtcaaggtggtcatcaagtccaactttaaaccctcactgctggctcagaagatcgaggtg
aggatcccaaccccactgaacacaagcggggtgcaggtgatctgcatgaaggggaaggcc
aagtacaaggccagcgagaatgccatcgtgtggaagatcaagcgcatggcaggcatgaag
gaatcgcagatcagcgcagagattgagcttctgcctaccaacgacaagaagaaatgggct
cgaccccccatttccatgaactttgaggtgccattcgcgccctctggcctcaaggtgcgc
tacttgaaggtgtttgaaccgaagctgaactacagcgaccatgatgtcatcaaatgggtg
cgctacattggccgcagtggcatttatgaaactcgctgctag

DBGET integrated database retrieval system