KEGG   Homo sapiens (human): 1175Help
Entry
1175              CDS       T01001                                 

Gene name
AP2S1, AP17, AP17-DELTA, CLAPS2, HHC3
Definition
adaptor-related protein complex 2, sigma 1 subunit
Orthology
K11827  
AP-2 complex subunit sigma-1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:hsa04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2-q13.3
AA seq 142 aa AA seqDB search
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctttatcctcatccagaaccgggcaggcaagacgcgcctggccaagtggtac
atgcagtttgatgatgatgagaaacagaagctgatcgaggaggtgcatgccgtggtcacc
gtccgagacgccaaacacaccaactttgtggagttccggaactttaagatcatttaccgc
cgctatgctggcctctacttctgcatctgtgtggatgtcaatgacaacaacctggcttac
ctggaggccattcacaacttcgtggaggtcttaaacgaatatttccacaatgtctgtgaa
ctggacctggtgttcaacttctacaaggtttacacggtcgtggacgagatgttcctggct
ggcgaaatccgagagaccagccagacgaaggtgctgaaacagctgctgatgctacagtcc
ctggagtga

DBGET integrated database retrieval system