KEGG   Homo sapiens (human): 1175Help
Entry
1175              CDS       T01001                                 

Gene name
AP2S1, AP17, AP17-DELTA, CLAPS2, FBH3, FBHOk, HHC3
Definition
adaptor-related protein complex 2, sigma 1 subunit
Orthology
K11827  
AP-2 complex subunit sigma-1
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    1175 (AP2S1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    1175 (AP2S1)
  Nervous system
   04721 Synaptic vesicle cycle
    1175 (AP2S1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    1175 (AP2S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2-q13.3
AA seq 142 aa AA seqDB search
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYR
RYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLA
GEIRETSQTKVLKQLLMLQSLE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctttatcctcatccagaaccgggcaggcaagacgcgcctggccaagtggtac
atgcagtttgatgatgatgagaaacagaagctgatcgaggaggtgcatgccgtggtcacc
gtccgagacgccaaacacaccaactttgtggagttccggaactttaagatcatttaccgc
cgctatgctggcctctacttctgcatctgtgtggatgtcaatgacaacaacctggcttac
ctggaggccattcacaacttcgtggaggtcttaaacgaatatttccacaatgtctgtgaa
ctggacctggtgttcaacttctacaaggtttacacggtcgtggacgagatgttcctggct
ggcgaaatccgagagaccagccagacgaaggtgctgaaacagctgctgatgctacagtcc
ctggagtga

DBGET integrated database retrieval system