KEGG   Homo sapiens (human): 1179Help
Entry
1179              CDS       T01001                                 

Gene name
CLCA1, CACC, CACC1, CLCRG1, CaCC-1, GOB5, hCLCA1, hCaCC-1
Definition
chloride channel accessory 1
Orthology
K05027  
calcium-activated chloride channel regulator 1
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Pancreatic secretion
Drug target
Niflumic acid: 
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p22.3
AA seq 914 aa AA seqDB search
MGPFKSSVFILILHLLEGALSNSLIQLNNNGYEGIVVAIDPNVPEDETLIQQIKDMVTQA
SLYLFEATGKRFYFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTE
QMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDEYNNDEKFYLSNG
RIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFA
QHVDSIVEFCTEQNHNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPMTTQPPNPTFSLL
QIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAAHVQNELI
QINSGSDRDTLAKRLPAAASGGTSICSGLRSAFTVIRKKYPTDGSEIVLLTDGEDNTISG
CFNEVKQSGAIIHTVALGPSAAQELEELSKMTGGLQTYASDQVQNNGLIDAFGALSSGNG
AVSQRSIQLESKGLTLQNSQWMNGTVIVDSTVGKDTLFLITWTMQPPQILLWDPSGQKQG
GFVVDKNTKMAYLQIPGIAKVGTWKYSLQASSQTLTLTVTSRASNATLPPITVTSKTNKD
TSKFPSPLVVYANIRQGASPILRASVTALIESVNGKTVTLELLDNGAGADATKDDGVYSR
YFTTYDTNGRYSVKVRALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDD
VQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDY
DHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDL
FIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILK
IMWKWIGELQLSIA
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggggccatttaagagttctgtgttcatcttgattcttcaccttctagaaggggccctg
agtaattcactcattcagctgaacaacaatggctatgaaggcattgtcgttgcaatcgac
cccaatgtgccagaagatgaaacactcattcaacaaataaaggacatggtgacccaggca
tctctgtatctgtttgaagctacaggaaagcgattttatttcaaaaatgttgccattttg
attcctgaaacatggaagacaaaggctgactatgtgagaccaaaacttgagacctacaaa
aatgctgatgttctggttgctgagtctactcctccaggtaatgatgaaccctacactgag
cagatgggcaactgtggagagaagggtgaaaggatccacctcactcctgatttcattgca
ggaaaaaagttagctgaatatggaccacaaggtagggcatttgtccatgagtgggctcat
ctacgatggggagtatttgacgagtacaataatgatgagaaattctacttatccaatgga
agaatacaagcagtaagatgttcagcaggtattactggtacaaatgtagtaaagaagtgt
cagggaggcagctgttacaccaaaagatgcacattcaataaagtaacaggactctatgaa
aaaggatgtgagtttgttctccaatcccgccagacggagaaggcttctataatgtttgca
caacatgttgattctatagttgaattctgtacagaacaaaaccacaacaaagaagctcca
aacaagcaaaatcaaaaatgcaatctccgaagcacatgggaagtgatccgtgattctgag
gactttaagaaaaccactcctatgacaacacagccaccaaatcccaccttctcattgctg
cagattggacaaagaattgtgtgtttagtccttgacaaatctggaagcatggcgactggt
aaccgcctcaatcgactgaatcaagcaggccagcttttcctgctgcagacagttgagctg
gggtcctgggttgggatggtgacatttgacagtgctgcccatgtacaaaatgaactcata
cagataaacagtggcagtgacagggacacactcgccaaaagattacctgcagcagcttca
ggagggacgtccatctgcagcgggcttcgatcggcatttactgtgattaggaagaaatat
ccaactgatggatctgaaattgtgctgctgacggatggggaagacaacactataagtggg
tgctttaacgaggtcaaacaaagtggtgccatcatccacacagtcgctttggggccctct
gcagctcaagaactagaggagctgtccaaaatgacaggaggtttacagacatatgcttca
gatcaagttcagaacaatggcctcattgatgcttttggggccctttcatcaggaaatgga
gctgtctctcagcgctccatccagcttgagagtaagggattaaccctccagaacagccag
tggatgaatggcacagtgatcgtggacagcaccgtgggaaaggacactttgtttcttatc
acctggacaatgcagcctccccaaatccttctctgggatcccagtggacagaagcaaggt
ggctttgtagtggacaaaaacaccaaaatggcctacctccaaatcccaggcattgctaag
gttggcacttggaaatacagtctgcaagcaagctcacaaaccttgaccctgactgtcacg
tcccgtgcgtccaatgctaccctgcctccaattacagtgacttccaaaacgaacaaggac
accagcaaattccccagccctctggtagtttatgcaaatattcgccaaggagcctcccca
attctcagggccagtgtcacagccctgattgaatcagtgaatggaaaaacagttaccttg
gaactactggataatggagcaggtgctgatgctactaaggatgacggtgtctactcaagg
tatttcacaacttatgacacgaatggtagatacagtgtaaaagtgcgggctctgggagga
gttaacgcagccagacggagagtgataccccagcagagtggagcactgtacatacctggc
tggattgagaatgatgaaatacaatggaatccaccaagacctgaaattaataaggatgat
gttcaacacaagcaagtgtgtttcagcagaacatcctcgggaggctcatttgtggcttct
gatgtcccaaatgctcccatacctgatctcttcccacctggccaaatcaccgacctgaag
gcggaaattcacgggggcagtctcattaatctgacttggacagctcctggggatgattat
gaccatggaacagctcacaagtatatcattcgaataagtacaagtattcttgatctcaga
gacaagttcaatgaatctcttcaagtgaatactactgctctcatcccaaaggaagccaac
tctgaggaagtctttttgtttaaaccagaaaacattacttttgaaaatggcacagatctt
ttcattgctattcaggctgttgataaggtcgatctgaaatcagaaatatccaacattgca
cgagtatctttgtttattcctccacagactccgccagagacacctagtcctgatgaaacg
tctgctccttgtcctaatattcatatcaacagcaccattcctggcattcacattttaaaa
attatgtggaagtggataggagaactgcagctgtcaatagcctag

DBGET integrated database retrieval system