KEGG   Homo sapiens (human): 118424Help
Entry
118424            CDS       T01001                                 

Gene name
UBE2J2, NCUBE-2, NCUBE2, PRO2121
Definition
ubiquitin-conjugating enzyme E2, J2 (EC:6.3.2.19)
Orthology
K04554  
ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Parkinson's disease
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.33
AA seq 259 aa AA seqDB search
MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccagcagtaagagggctccgaccacggcaacccagaggctgaagcaggac
taccttcgcattaagaaagacccggtgccttacatctgtgccgagcccctcccttcgaat
attctcgagtggcactatgtcgtccgaggcccagagatgaccccttatgaaggtggctat
tatcatggaaaactaatttttcccagagaatttcctttcaaacctcccagtatctatatg
atcactcccaacgggaggtttaagtgcaacaccaggctgtgtctttctatcacggatttc
cacccggacacgtggaacccggcctggtctgtctccaccatcctgactgggctcctgagc
ttcatggtggagaagggccccaccctgggcagtatagagacgtcggacttcacgaaaaga
caactggcagtgcagagtttagcatttaatttgaaagataaagtcttttgtgaattattt
cctgaagtcgtggaggagattaaacaaaaacagaaagcacaagacgaactcagtagcaga
ccccagactctccccttgccagacgtggttccagacggggagacgcacctcgtccagaac
gggattcagctgctcaacgggcatgcgccgggggccgtcccaaacctcgcagggctccag
caggccaaccggcaccacggactcctgggtggcgccctggcgaacttgtttgtgatagtt
gggtttgcagcctttgcttacacggtcaagtacgtgctgaggagcatcgcgcaggagtga

DBGET integrated database retrieval system