KEGG   Homo sapiens (human): 118424Help
Entry
118424            CDS       T01001                                 

Gene name
UBE2J2, NCUBE-2, NCUBE2, PRO2121
Definition
ubiquitin-conjugating enzyme E2, J2 (EC:6.3.2.19)
Orthology
K04554  
ubiquitin-conjugating enzyme E2 J2 [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    118424 (UBE2J2)
   04120 Ubiquitin mediated proteolysis
    118424 (UBE2J2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    118424 (UBE2J2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     118424 (UBE2J2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.33
AA seq 259 aa AA seqDB search
MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaccagcagtaagagggctccgaccacggcaacccagaggctgaagcaggac
taccttcgcattaagaaagacccggtgccttacatctgtgccgagcccctcccttcgaat
attctcgagtggcactatgtcgtccgaggcccagagatgaccccttatgaaggtggctat
tatcatggaaaactaatttttcccagagaatttcctttcaaacctcccagtatctatatg
atcactcccaacgggaggtttaagtgcaacaccaggctgtgtctttctatcacggatttc
cacccggacacgtggaacccggcctggtctgtctccaccatcctgactgggctcctgagc
ttcatggtggagaagggccccaccctgggcagtatagagacgtcggacttcacgaaaaga
caactggcagtgcagagtttagcatttaatttgaaagataaagtcttttgtgaattattt
cctgaagtcgtggaggagattaaacaaaaacagaaagcacaagacgaactcagtagcaga
ccccagactctccccttgccagacgtggttccagacggggagacgcacctcgtccagaac
gggattcagctgctcaacgggcatgcgccgggggccgtcccaaacctcgcagggctccag
caggccaaccggcaccacggactcctgggtggcgccctggcgaacttgtttgtgatagtt
gggtttgcagcctttgcttacacggtcaagtacgtgctgaggagcatcgcgcaggagtga

DBGET integrated database retrieval system